DeFi Education Fund urges Senate to strengthen crypto dev protections in draft bill !DeFi Education Fund urges Senate to strengthen crypto dev protections in draft … By Cointelegraph 2025-08-02
Strategy expands STRC offering twice in two weeks !Strategy expands STRC offering twice in two weeksimagesnewsstrategy-expands-strc-offering-twice-in-two-weeks02f1053b441e.jpg The company continues … By Cointelegraph 2025-08-01
SEC Chair Aktins calls to ‘reshore crypto’ as companies move back to the US !SEC Chair Aktins calls to reshore crypto as companies move back to the … By Cointelegraph 2025-08-01
SEC’s crypto task force to hit the road with 10 roundtables across the US !SECs crypto task force to hit the road with 10 roundtables across the USimagesnewssecs-crypto-task-force-to-hit-the-road-with-10-rou5dbcd6da38db.jpg … By Cointelegraph 2025-08-01
Bitcoin, Ethereum and XRP Sink as Crypto Liquidations Top $900 Million Amid a confluence of bearish political and economic developments, Bitcoin and other assets are down while liquidations only keep rising. By Decrypt 2025-08-01
Hong Kong stablecoin stocks slide as new rules take effect, experts see healthy reset !Hong Kong stablecoin stocks slide as new rules take effect, experts see healthy … By Cointelegraph 2025-08-01
As Trump challenges Fed independence, key FOMC member resigns !As Trump challenges Fed independence, key FOMC member resignsimagesnewsas-trump-challenges-fed-independence-key-fomc-memb9a069a038397.jpg Adriana … By Cointelegraph 2025-08-01
Public Keys: Strategy Eyes Domination, Metaplanet Bitcoin Barrage, and Coinbase XRP Boost MicroStrategy aims to have the biggest corporate treasury stash everBitcoin or otherwisewhile Metaplanet raises 3.7 billion for its BTC buying spree. By Decrypt 2025-08-01
Crypto Biz: Digital gold rush intensifies as Tether Gold surges, institutions double down on BTC !Crypto Biz Digital gold rush intensifies as Tether Gold surges, institutions double down on … By Cointelegraph 2025-08-01
Ancient Bitcoin Whale Moves Millions in BTC After 12 Years Selling from long-term holders could lead to a months-long correction, analysts at CryptoQuant warned earlier this week. By Decrypt 2025-08-01
OpenAI raises $8.3B at $300B valuation !OpenAI raises 8.3B at 300B valuationimagesnewsopenai-raises-8-3b-at-300b-valuationbf81b8b83093.jpg OpenAIs latest funding round, which values the … By Cointelegraph 2025-08-01
Crypto Rally Stalls as Dogecoin Tanks and Bitcoin Tests Key Support: Analysis The overall crypto market had a rough week. Bitcoin is holding onto key price supportbut barely. By Decrypt 2025-08-01
Can Google Gemini really help plan crypto trades? !Can Google Gemini really help plan crypto trades?imagesnewscan-google-gemini-really-help-plan-crypto-trades1db9df686f8c.jpg Gemini looks smart, but … By Cointelegraph 2025-08-01
Bitcoin’s Independence Day: 8 years after the Block Size Wars !Bitcoins Independence Day 8 years after the Block Size Warsimagesnewsbitcoins-independence-day-8-years-after-the-block-281a97fe6f35.jpg The value of … By Cointelegraph 2025-08-01
Bitcoin price dip shakes trader confidence: Is the 2025 bull run in danger? !Bitcoin price dip shakes trader confidence Is the 2025 bull run in … By Cointelegraph 2025-08-01
Crypto Carnage Continues Even as Gold, Bonds Surge on Soft U.S. Jobs Data Soft U.S. July jobs numbers httpswww.coindesk.commarkets20250801u-s-added-just-73k-jobs-in-july-unemployment-rate-rose-to-4-2released Friday morning … By CoinDesk 2025-08-01
Crypto ETFs See Record $12.8B Inflows in July as Market Rallies to New Highs Crypto exchange-traded funds on U.S. exchanges recorded their strongest month ever in July, attracting 12.8 billion in net inflows as investor … By CoinDesk 2025-08-01
Crypto treasuries top $100B for Ethereum’s 10th anniversary: Finance Redefined !Crypto treasuries top 100B for Ethereums 10th anniversary Finance … By Cointelegraph 2025-08-01
What Bitcoin's Velocity Says About Its Future Bitcoins on-chain velocityhow often coins moveis at decade lows. To some, thats a red flag has Bitcoin lost momentum? Is it still being used? In … By CoinDesk 2025-08-01
Red Coin, Blue Coin: The New Politics of Exposure It was only a matter of time. With Strategyhttpswww.microstrategy.comenbitcoin long reigning as the go-to corporate proxy for bitcoin exposure, it … By CoinDesk 2025-08-01
Strategy Could Buy as Much as 7% of Bitcoin Supply, Says Michael Saylor Bitcoin treasury giant Strategy already holds 72 billion worth of BTC, but Michael Saylor has even larger ambitions. By Decrypt 2025-08-01
XRP’s ‘bullish divergence’ raises 20% price rally potential in August !XRPs bullish divergence raises 20 price rally potential in Augustimagesnewsxrps-bullish-divergence-raises-20-price-rally-potea7c00f6502db.jpg XRPs … By Cointelegraph 2025-08-01
Crypto exchange Gate launches spot trading services in the US !Crypto exchange Gate launches spot trading services in the USimagesnewscrypto-exchange-gate-launches-spot-trading-service4c3999a23530.jpg Gate … By Cointelegraph 2025-08-01
Ric Edelman's crypto shift: from 1% to 40% allocation !Ric Edelmans crypto shift from 1 to 40 allocationimagesnewsric-edelman-s-crypto-shift-from-1-to-40-allocation1ec7f1cc640c.jpg Veteran financial … By Cointelegraph 2025-08-01
Polkadot's DOT Suffers 5% Decline as Intensified Selling Pressure Overwhelms Market Polkadots DOT encountered substantial bearish momentum over the last 24 hours, retreating from 3.76 to 3.56, or more than 5, according to CoinDesk … By CoinDesk 2025-08-01
Crypto stocks tumble alongside BTC, equities as tariff fears resurface !Crypto stocks tumble alongside BTC, equities as tariff fears resurfaceimagesnewscrypto-stocks-tumble-alongside-btc-equities-as-tarfcdb9dda5574.jpg … By Cointelegraph 2025-08-01
Hong Kong's Stablecoin Rules Kick In as It Looks to Establish Its Crypto Credentials Hong Kongs rules for stablecoin issuers took effect on Friday as the government pursues its ambitions for the crypto sector. The special … By CoinDesk 2025-08-01
Why a mystery whale is quietly accumulating 331 million Pi coins !Why a mystery whale is quietly accumulating 331 million Pi coinsimagesnewswhy-a-mystery-whale-is-quietly-accumulating-331-mi224a2a32e29b.jpg A … By Cointelegraph 2025-08-01
Regulators Handed the Crypto Industry a 5-Year Head Start. Can Wall Street Catch Up? With the passage of the GENIUS Act and growing momentum behind the CLARITY bills in Congress, regulatory clarity for digital assets is finally within … By CoinDesk 2025-08-01
Gemini's Tyler Winklevoss Says Trump CFTC Pick Quintenz Has 'Disqualifying' Views Tyler Winklevoss, the CEO of crypto exchange Gemini, is at the center of a rift over support of President Donald Trumps nominee to run the … By CoinDesk 2025-08-01
How a police officer stole 50 BTC from a seized crypto wallet and got caught !How a police officer stole 50 BTC from a seized crypto wallet and got … By Cointelegraph 2025-08-01
BTC ATH MONTHLY, TRUMP SPOOKS MARKETS, ALTCOINS LEAD FALLS Bitcoin records ATH monthly close then falls. Altcoins lead crypto sell-off after mixed earnings. SEC launches Project Crypto to tokenise assets. … By Decrypt 2025-08-01
Strategy Stock Price Could Nearly Double as Bitcoin Treasury Aims to Dominate Market: Benchmark Strategy gets 705 target as analyst sees Bitcoin hitting 225K by 2026 amid its push to become the worlds largest corporate treasury. By Decrypt 2025-08-01
Price predictions 8/1: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, XLM, SUI !Price predictions 81 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, XLM, SUIimagesnewsprice-predictions-8-1-btc-eth-xrp-bnb-sol-doge-adae81e48aebc37.jpg … By Cointelegraph 2025-08-01
BONK Sinks 5% as Institutional Liquidation Intensifies BONK, the Solana-native meme cryptocurrency, declined nearly 5 over the last 24 hours, sliding from 0.000028 to … By CoinDesk 2025-08-01
Bitcoin, Ethereum Sink as Tariff Gloom Tops Rate Cut Optimism Traders grew more confident that the Federal Reserve will cut interest rates next month after a weaker-than-expected jobs report. By Decrypt 2025-08-01
DeFi shouldn’t fear ‘suitcoiners’ !DeFi shouldnt fear suitcoinersimagesnewsdefi-shouldnt-fear-suitcoiners2fe1081c77df.jpg DeFis future depends on embracing institutional investors, … By Cointelegraph 2025-08-01
Bitcoin traders warn $123K was a top: How low can BTC price go? !Bitcoin traders warn 123K was a top How low can BTC price go?imagesnewsbitcoin-traders-warn-123k-was-a-top-how-low-can-bt58f27ceb4688.jpg Bitcoins … By Cointelegraph 2025-08-01
Bitcoin rejects at $116K despite US jobs win as Fed rate cut bets pass 75% !Bitcoin rejects at 116K despite US jobs win as Fed rate cut bets pass 75imagesnewsbitcoin-rejects-at-116k-despite-us-jobs-win-as-fed29ba464a0bf2.jpg … By Cointelegraph 2025-08-01
UK regulator lifts ban on crypto ETNs for retail investors !UK regulator lifts ban on crypto ETNs for retail investorsimagesnewsuk-regulator-lifts-ban-on-crypto-etns-for-retail-id2fb982a6712.jpg After banning … By Cointelegraph 2025-08-01
Shiba Inu Tanks 6% But 'Inverted Hammer' Offers Hope to Bulls Shiba inu SHIB dropped sharply early Friday as President Donald Trumps new tariffs weighed on market leader bitcoin and strengthened the U.S. dollar. … By CoinDesk 2025-08-01
State of stablecoins after GENIUS Act: Expert weighs in !State of stablecoins after GENIUS Act Expert weighs inimagesnewsstate-of-stablecoins-after-genius-act-expert-weigh31d9c6b6ce19.jpg Following the … By Cointelegraph 2025-08-01
Filecoin Drops Over 6%, Breaks Key Support at the $2.38 Level Filecoin FIL displayed sharp volatility with a trading range of over 6 during the last 24-hours, according to CoinDesk Researchs technical analysis … By CoinDesk 2025-08-01
Bitcoin Mining Profitability Last Month Hit Highest Level Since the Halving: JPMorgan Bitcoin BTC miners enjoyed another strong month in July, with profitability reaching the highest level since the last halving event, Wall Street bank … By CoinDesk 2025-08-01
CoinDesk 20 Performance Update: Bitcoin (BTC) Price Drops 1.3% as All Assets Decline CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-08-01
Metaplanet Plans $3.7B Stock Raise to Fuel Massive Bitcoin Buying Spree The stock offering would establish new perpetual preferred shares with up to 6 dividends, all proceeds earmarked for BTC acquisitions. By Decrypt 2025-08-01
GENIUS sets new stablecoin rules but remains vague on foreign issuers !GENIUS sets new stablecoin rules but remains vague on foreign issuersimagesnewsgenius-sets-new-stablecoin-rules-but-remains-vagued293c768857f.jpg … By Cointelegraph 2025-08-01
Tether’s US Treasury holdings hit $127B, surpassing South Korea !Tethers US Treasury holdings hit 127B, surpassing South Koreaimagesnewstethers-us-treasury-holdings-hit-127b-surpassing-s76d22d20f157.jpg Tethers … By Cointelegraph 2025-08-01
The Hashgraph Group unveils IDTrust to challenge Worldcoin and Microsoft !The Hashgraph Group unveils IDTrust to challenge Worldcoin and Microsoftimagesnewsthe-hashgraph-group-unveils-idtrust-to-challenge-w8ab656099b29.jpg … By Cointelegraph 2025-08-01
Tokenization of Real-World Assets is Gaining Momentum, Says Bank of America While U.S. dollar-backed stablecoins continue to dominate the conversation, recent discussions with investors indicate a growing focus on the … By CoinDesk 2025-08-01
SBF Loves Coldplay? Crypto and AI Leaders' Spotify Playlists Leaked Brian Armstrong, Sam Bankman-Fried, Sam Altman, and many other tech leaders have had their Spotify accounts leaked. By Decrypt 2025-08-01
U.S. Added Just 73K Jobs in July, Unemployment Rate Rose to 4.2% U.S. jobs market growth slowed considerably not just last month, but in May and June as well, likely giving more fuel to those calling for Federal … By CoinDesk 2025-08-01
Crypto Treasury Companies Risk Ignoring Lessons from History, Warns Galaxy The rapidly-expanding crop of public companies using their stock to accumulate digital asset treasuries ought to trigger lessons from history about … By CoinDesk 2025-08-01
BNB Slides as Tariffs, Stronger Dollar and Fed Policy Weigh on Crypto Markets BNB fell more than 4.5 in the last 24 hours, dropping from around 805.7 to 766 at the time of writing as investors move away from risk assets as U.S. … By CoinDesk 2025-08-01
Ethena's USDe Outpaces BlackRock’s Bitcoin, Ether ETFs With $3.1B Inflow Surge Ethenashttpswww.coindesk.comtagethena synthetic stablecoin, USDe, has crossed 8.4 billion in supply, adding more than 3.14 billion over 20 days in a … By CoinDesk 2025-08-01
Assetera Opens Tokenized Securities Market to Crypto Exchanges With MiFID-Compliant API Assetera, a regulated trading platform based in Austria, introduced an API that allows cryptocurrency exchanges to offer tokenized financial products … By CoinDesk 2025-08-01
Metaplanet plans to raise additional $3.7B to buy Bitcoin !Metaplanet plans to raise additional 3.7B to buy Bitcoinimagesnewsmetaplanet-plans-to-raise-additional-3-7b-to-buy-b67ed0680fd5d.jpg The Japanese … By Cointelegraph 2025-08-01
Andreessen Horowitz warns of loopholes in draft crypto rules !Andreessen Horowitz warns of loopholes in draft crypto rulesimagesnewsandreessen-horowitz-warns-of-loopholes-in-draft-cr2b684f03f4a6.jpg Andreessen … By Cointelegraph 2025-08-01
Bitcoin Slides as Rate-Cut Hopes Fade: Crypto Daybook Americas By Francisco Rodrigues All times ET unless indicated otherwise The wind seems to be coming out of the crypto markets sails. Bitcoin BTC fell 3 in the … By CoinDesk 2025-08-01
Ray Dalio sells final Bridgewater stake after predicting debt collapse !Ray Dalio sells final Bridgewater stake after predicting debt collapseimagesnewsray-dalio-sells-final-bridgewater-stake-after-predca4b96e83daa.jpg … By Cointelegraph 2025-08-01
Spot Ether ETFs clock $5.4B monthly inflow record amid 20-day streak !Spot Ether ETFs clock 5.4B monthly inflow record amid 20-day streakimagesnewsspot-ether-etfs-clock-5-4b-monthly-inflow-record-a2a44bea5f484.jpg Spot … By Cointelegraph 2025-08-01
FDIC Still Trying to ‘Stonewall’ Crypto Debanking Documents, Says Coinbase Legal Chief We cant and wont stand for it, said Coinbase Chief Legal Officer Paul Grewal as the crypto exchange filed an opposition brief. By Decrypt 2025-08-01
Bitcoin ends record month at $115K with BTC price set for 'vertical' August !Bitcoin ends record month at 115K with BTC price set for vertical Augustimagesnewsbitcoin-ends-record-month-at-115k-with-btc-price-s935cdb3b5df6.jpg … By Cointelegraph 2025-08-01
Salvadoran President Nayib Bukele can now run for election indefinitely !Salvadoran President Nayib Bukele can now run for election indefinitelyimagesnewssalvadoran-president-nayib-bukele-can-now-run-for-89545744e4fc.jpg … By Cointelegraph 2025-08-01
Are Traders Done With Ether? Options Market Now Prices Higher Risk for ETH Than BTC Its become more expensive to use derivatives to insure against a decline in ether ETH than in bitcoin BTC, indicating that market sentiment has … By CoinDesk 2025-08-01
Amazon Backs 'Netflix of AI' Startup Fable With User-Generated Animation Launch The platform lets users generate entire episodes from prompts or photos, with Amazon betting on a new mode of storytelling. By Decrypt 2025-08-01
CoinDCX Engineer Arrested Following July's $43.4M Exploit: Report Police in Bengaluru, India arrested a CoinDCX software engineer in connection with the theft of 3.79 billion rupees 43.4 million in crypto assets … By CoinDesk 2025-08-01
Bitcoin fills July CME gap 'to the dollar' amid $104K BTC price target !Bitcoin fills July CME gap to the dollar amid 104K BTC price targetimagesnewsbitcoin-fills-july-cme-gap-to-the-dollar-amid-104kdc1f54e34e39.jpg BTC … By Cointelegraph 2025-08-01
Crypto hacks top $142M in July, with CoinDCX leading losses !Crypto hacks top 142M in July, with CoinDCX leading lossesimagesnewscrypto-hacks-top-142m-in-july-with-coindcx-leading3e188ea904bb.jpg During the … By Cointelegraph 2025-08-01
Crypto Markets See Red as Solana, XRP, Dogecoin Extend Losses Solana, XRP, and Dogecoin are experiencing sharp downturns as investor sentiment turns cautious, Decrypt was told. By Decrypt 2025-08-01
Democrats press bank regulator on Trump stablecoin conflicts !Democrats press bank regulator on Trump stablecoin conflictsimagesnewsdemocrats-press-bank-regulator-on-trump-stablecoin1b78c0f954a3.jpg Democratic … By Cointelegraph 2025-08-01
Michael Saylor Touts Bitcoin-Tied Preferred Stock as 'High-Yield' Option for Retirees Bitcoin-backed yield products may appeal to retirees seeking alternative income, but only if structured with safeguards, sources told Decrypt. By Decrypt 2025-08-01
XRP Edges Out Ethereum in Coinbase Transaction Revenue as Token Shifts Persist XRP edged out Ethereum in Coinbases Q2 retail revenue even as ETH regained ground from a weaker first quarter. By Decrypt 2025-08-01
Bitcoin, Ether Start August on a Shaky Note as Dollar Index Tops 100; Yen Hits 4-Month Low Ahead of Nonfarm Payrolls Major cryptocurrencies experienced two-way price action early Friday, as the dollar remained bid against major fiat currencies following President … By CoinDesk 2025-08-01
Bitcoin Correction Could Linger for Months: CryptoQuant Bitcoin faces near-term pressure from whales and miners cashing out, even as long-term models and seasonal trends point to renewed upside. By Decrypt 2025-08-01
Hong Kong Kicks Off Stablecoin Licensing Regime With Eye on Global Hub Hong Kongs new stablecoin licensing regime takes effect, tightening rules as the city vies for a global crypto edge. By Decrypt 2025-08-01
Michael Saylor joins chorus for clarity as US works to legally define crypto !Michael Saylor joins chorus for clarity as US works to legally define … By Cointelegraph 2025-08-01
Monster week for crypto treasury firms with $8B buying blitz !Monster week for crypto treasury firms with 8B buying blitzimagesnewsmonster-week-for-crypto-treasury-firms-with-8b-buy79cd41a844eb.jpg … By Cointelegraph 2025-08-01
ETH recovery outpaces Bitcoin despite constant selling at $4K: Here’s why !ETH recovery outpaces Bitcoin despite constant selling at 4K Heres whyimagesnewseth-recovery-outpaces-bitcoin-despite-constant-sel6e2ba67e5aa3.jpg … By Cointelegraph 2025-08-01
DOGE Suffers 8% Drop but Signs of Institutional Accumulation at 21-Cents What to Know DOGE dropped 8 from 0.22 to 0.21 between 0300 on July 31 and 0200 on August 1, marking one of the steepest daily declines this month. … By CoinDesk 2025-08-01
Bitcoin dips below $115K as Trump tariff order fails to comfort investors !Bitcoin dips below 115K as Trump tariff order fails to comfort investorsimagesnewsbitcoin-dips-below-115k-as-trump-tariff-order-failb21702bd1527.jpg … By Cointelegraph 2025-08-01
OG Bitcoiners are rotating out, but it’s a healthy dynamic: Analysts !OG Bitcoiners are rotating out, but its a healthy dynamic Analystsimagesnewsog-bitcoiners-are-rotating-out-but-its-a-healthy-db487137b9719.jpg Old … By Cointelegraph 2025-08-01
XRP Falls 8% Below $3 After Hitting Resistance, High-Volume Selloff Signals Weakness What to Know XRP declined 8 over the past 24 hours, falling from a session high of 3.17 to a low of 2.94, as intense sell pressure overwhelmed … By CoinDesk 2025-08-01
$600M Bullish Bets Liquidated as Bitcoin Drops to $115K, DOGE, SOL, XRP Fall 6% Crypto markets experienced a sharp bout of volatility over the past 24 hours, with more than 630 million in leveraged positions liquidated across … By CoinDesk 2025-08-01
Solv Protocol Introduces Automated Yield Generation for Bitcoin Holders Solv Protocol, which offers financial services to bitcoin BTC holders, announced BTC, an automated vault for generating returns on spot market … By CoinDesk 2025-08-01
Solv Protocol targets over $1T in idle Bitcoin with institutional yield vault !Solv Protocol targets over 1T in idle Bitcoin with institutional yield … By Cointelegraph 2025-08-01
Asia Morning Briefing: Bitcoin Drops to $115K as Third Major Profit-Taking, New Tariff Tensions Add Pressure Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-08-01
Strategy CEO calls it ‘most misunderstood’ stock amid record profit !Strategy CEO calls it most misunderstood stock amid record profitimagesnewsstrategy-ceo-calls-it-most-misunderstood-stock-amicd23827c5e83.jpg … By Cointelegraph 2025-08-01
JPMorgan Boss Jamie Dimon Praises Stablecoins, Remains Bitcoin Skeptic JP Morgan Chase CEO and former crypto critic Jamie Dimon has praised stablecoins but still says he doesnt believe in Bitcoin. By Decrypt 2025-07-31
Push for liquid staking in Solana ETFs gains institutional support !Push for liquid staking in Solana ETFs gains institutional supportimagesnewspush-for-liquid-staking-in-solana-etfs-gains-insti82f288cd2e26.jpg … By Cointelegraph 2025-07-31
Visa Adds More Stablecoin Features, Unveiling Avalanche, Stellar Support Visa has grown its stablecoin settlement infrastructure to support three new tokens and two extra blockchains in its latest crypto push. By Decrypt 2025-07-31
From skeptic to supporter: JPMorgan CEO now a 'believer' in stablecoins, blockchain !From skeptic to supporter JPMorgan CEO now a believer in stablecoins, … By Cointelegraph 2025-07-31
Ethereum researcher pitches ‘Lean’ network for quantum era !Ethereum researcher pitches Lean network for quantum eraimagesnewsethereum-researcher-pitches-lean-network-for-quant0e18dd4755fa.jpg The proposal … By Cointelegraph 2025-07-31
Ether Eyes Biggest Monthly Gain Since 2022 as ETFs, Corporate Treasuries Drive Rally Ether ETH, the native token of the Ethereum blockchain that turned … By CoinDesk 2025-07-31
Coinbase misses Q2 revenue estimates, but stablecoin growth, policy wins offer hope !Coinbase misses Q2 revenue estimates, but stablecoin growth, policy wins offer … By Cointelegraph 2025-07-31
Why This SharpLink Whale Holds Millions in SBET—But Not Ethereum SharpLink Whale currently holds more than 3.2 million worth of SBET, but literally no Ethereumheres why. By Decrypt 2025-07-31
Coinbase Increases Bitcoin Holdings, Plans Tokenized Stocks In U.S. Coinbase COIN said it is increasing its bitcoin BTC holdings and that it plans to launch tokenized U.S. stocks and prediction markets in the coming … By CoinDesk 2025-07-31
Bitcoin range chop continues, but a breakout is brewing !Bitcoin range chop continues, but a breakout is brewingimagesnewsbitcoin-range-chop-continues-but-a-breakout-is-bre731150284fc8.jpg Bitcoins range … By Cointelegraph 2025-07-31
Coinbase Stock Dives as Company Misses Q2 Revenue Forecasts The US-based crypto exchange clocked 1.5 billion in revenue, coming in below analysts expectations. By Decrypt 2025-07-31
Strategy Looking to Raise $4.2B Via Preferred Stock to Stack More Bitcoin Strategy MSTR, the largest corporate holder of bitcoin, plans to raise as much as 4.2 billion through sales of a newly issued preferred stock series, … By CoinDesk 2025-07-31
Bitcoin’s Momentum Is Losing Steam as Seasonal Headwinds Loom, 10x Research Says Bitcoin BTC has been trading in an excruciatingly tight range just below 120,000, but the rally is quickly losing momentum as the market enters what … By CoinDesk 2025-07-31
Coinbase Stock Tumbles 7% After Disappointing Q2 Results Coinbase COIN reportedhttpsinvestor.coinbase.comfilesdocfinancials2025q2Q2-2025-Shareholder-Letter.pdf worse than expected second-quarter results on … By CoinDesk 2025-07-31
Strategy Reports $10 Billion Q2 Profit, Plans to Raise $4.2 Billion to Buy More Bitcoin The Bitcoin-buying firm owns 3 of the assets total supply. By Decrypt 2025-07-31
Strategy Earned $10B in Q2 on Back of Bitcoin Price Gain Disclaimer The analyst who co-wrote this piece owns shares of Strategy MSTR. Strategy MSTR, the largest corporate holder of bitcoin BTC, posted … By CoinDesk 2025-07-31
Visa expands stablecoin offerings amid rising competition from institutions !Visa expands stablecoin offerings amid rising competition from … By Cointelegraph 2025-07-31
Blockstream Debuts Simplicity, a Leaner Smart Contract Language for Bitcoin Simplicity launches on the Liquid sidechain, aiming to avoid Ethereum-style bloat, but experts warn of centralization concerns. By Decrypt 2025-07-31
Tether posts $4.9B profit in Q2 as stablecoins go mainstream !Tether posts 4.9B profit in Q2 as stablecoins go mainstreamimagesnewstether-posts-4-9b-profit-in-q2-as-stablecoins-go-m235845ba3449.jpg In the first … By Cointelegraph 2025-07-31
Ethereum's Justin Drake Unveils ‘Lean’ Roadmap to Fend Off Quantum Threats Ethereum Foundation researcher Justin Drake has introduced a new framework for the networks long-term development called Lean Ethereum, aimed at … By CoinDesk 2025-07-31
Bitcoin Sits Tight, But There’s One Solana Token Turning Heads: Analysis Last weeks worst-performing token is todays best, providing a little excitement to an otherwise boring crypto trading day. By Decrypt 2025-07-31
SEC crypto ETFs ruling brings structural fix, not retail shakeup: Analysts !SEC crypto ETFs ruling brings structural fix, not retail shakeup … By Cointelegraph 2025-07-31
Tech Darling Figma Soars 198% Following IPO; Holds $70M in Bitcoin ETF Shares of Figma FIG rose 198 on its first day of trading on the New York Stock Exchange after the company raised 1.2 billion for its Wednesday … By CoinDesk 2025-07-31
Tether Reports Q2 Profit of $4.9 Billion, CEO Teases U.S. Venture The stablecoin giant said it has 127 billion in exposure to U.S. Treasuries. By Decrypt 2025-07-31
New whales trigger Bitcoin’s third profit-taking wave of current cycle !New whales trigger Bitcoins third profit-taking wave of current cycleimagesnewsnew-whales-trigger-bitcoins-third-profit-taking-wa0bec319e4db7.jpg A … By Cointelegraph 2025-07-31
Fold Taps Blackhawk to Bring Bitcoin Gift Cards to Over 400K Retailers The companies want to make BTC as accessible and flexible as possible for both new and experienced users. By Decrypt 2025-07-31
SEC Chair Paul Atkins Unveils Project Crypto, Greenlighting ICOs, Airdrops and More The SEC also plans to create new registration pathways for DeFi platforms and allow certain crypto investment contracts to trade on unregulated … By Decrypt 2025-07-31
This Game Lets You Relive the Ethereum Story Through Vitalik Buterin’s Eyes Ethereum co-founder Vitalik Buterin wrote the original ETH whitepaper while battling World of Warcraft distractionsand now you can do the same. By Decrypt 2025-07-31
Bitcoin ’tick tock’ fractal predicts $150K BTC price top in October !Bitcoin tick tock fractal predicts 150K BTC price top in Octoberimagesnewsbitcoin-tick-tock-fractal-predicts-150k-btc-price-7dcfa30e36f5.jpg Bitcoin … By Cointelegraph 2025-07-31
Myriad Protocol Rolls Out Expansion to Ethereum L2 Linea The launch will lay the groundwork for Myriads multichain expansion, creating a new class of DeFi products using prediction contracts. By Decrypt 2025-07-31
Why Robinhood’s CEO Touted Tokenization 11 Times on Its Q2 Earning Call Vlad Tenev views tokenization as more than just a buzzword. By Decrypt 2025-07-31
US SEC rolls out ‘Project Crypto’ to rewrite rules for digital assets !US SEC rolls out Project Crypto to rewrite rules for digital assetsimagesnewsus-sec-rolls-out-project-crypto-to-rewrite-rules-f62e6cf7ff2cf.jpg The … By Cointelegraph 2025-07-31
SEC’s Atkins: 'Most Crypto Assets Are Not Securities' Under Bold New Vision WASHINGTON, D.C. Securities and Exchange Commission SEC Chairman Paul Atkins said his agency is launching Project Crypto with an aim to make a quick … By CoinDesk 2025-07-31
Tether Reports $4.9B Net Profit in Q2, Invested $4B in U.S. Initiatives Tether International Ltd., the holding company behind the largest stablecoin, USDT, posted second-quarter net profit of 4.9 … By CoinDesk 2025-07-31
Adam Beck's Blockstream Unveils Bitcoin-Powered, Liquid Network-Based Smart Contracts Bitcoin development firm Blockstream has unveiled Simplicity, a programming language for smart contracts built on the layer-2 network Liquid. … By CoinDesk 2025-07-31
Blockstream debuts Simplicity as Bitcoin’s answer to Ethereum’s Solidity !Blockstream debuts Simplicity as Bitcoins answer to Ethereums Solidityimagesnewsblockstream-debuts-simplicity-as-bitcoins-answer-t9b20144737bb.jpg … By Cointelegraph 2025-07-31
Helium Plus Lets Businesses Join Solana DePIN Project With Just Wi-Fi Helium, one of the most well-known DePIN projects on Solana, is launching a new service called Helium Plus, aimed at transforming how businesses … By CoinDesk 2025-07-31
Former OpenSea Manager Has Conviction Overturned in First-Ever Crypto Insider Trading Case Former OpenSea product manager Nathanial Chastain was convicted in 2023 of wire fraud and money laundering for profiting off inside information on … By Decrypt 2025-07-31
Ethereum derivatives show no momentum, raising doubts over $4K rally !Ethereum derivatives show no momentum, raising doubts over 4K rallyimagesnewsethereum-derivatives-show-no-momentum-raising-doubb763005167f4.jpg … By Cointelegraph 2025-07-31
CRYPTO BOUNCES BACK, FED HOLDS STEADY, REKT NEARS ATH Crypto majors reverse overnight losses. WH releases crypto report, slight anti-climax. US must lead crypto revolution Atkins. SEC outlines listing … By Decrypt 2025-07-31
White House crypto report a mixed bag for Bitcoin advocates !White House crypto report a mixed bag for Bitcoin advocatesimagesnewswhite-house-crypto-report-a-mixed-bag-for-bitcoin-48e5d1868c0b.jpg The White … By Cointelegraph 2025-07-31
Bitcoin Whales Bought 1% of Circulating BTC Supply in Past 4 Months Bitcoin whales accumulated nearly 1 of circulating BTC supply in recent months while diversifying into other crypto assets amid mixed market signals. By Decrypt 2025-07-31
Crypto for Advisors: Ethereum Just Turned Ten Yesterday, July 30th, was the 10-year anniversary of Ethereums launch. In todays Crypto for Advisors newsletter, Alec … By CoinDesk 2025-07-31
The rise of Money2: The next financial system has already begun !The rise of Money2 The next financial system has already begunimagesnewsthe-rise-of-money2-the-next-financial-system-has-a03c788743b65.jpg Money2 is … By Cointelegraph 2025-07-31
Robinhood's Strong Q2 Fails to Sway Cautious Wall Street Analysts Robinhoods HOOD strong second-quarter earnings Wednesday evening have prompted Wall Street to raise its expectations for the stock, but the modest … By CoinDesk 2025-07-31
Appeals court overturns Nate Chastain's conviction in OpenSea insider trading case !Appeals court overturns Nate Chastains conviction in OpenSea insider trading … By Cointelegraph 2025-07-31
Visa Expands Settlement Platform to Stellar, Avalanche, Adds Support for 3 Stablecoins Global payments provider Visa V is expanding its stablecoin settlement platform to new blockchains and stablecoins, the company … By CoinDesk 2025-07-31
Bitcoin’s quantum threat: Naoris offers bounty to break crypto encryption !Bitcoins quantum threat Naoris offers bounty to break crypto encryptionimagesnewsbitcoins-quantum-threat-naoris-offers-bounty-to-br9c9e43912e10.jpg … By Cointelegraph 2025-07-31
Bitcoin is now bigger than Amazon: Here’s how it became a top-5 asset !Bitcoin is now bigger than Amazon Heres how it became a top-5 assetimagesnewsbitcoin-is-now-bigger-than-amazon-heres-how-it-bec30d0535db96e.jpg … By Cointelegraph 2025-07-31
Stablecoins Speed Up Thanks to ‘AWS of Crypto’ Alchemy’s Latest Upgrade Stablecoins, the dollar-pegged tokens that now rival the volumes of Visa and Mastercard for international payments, are about to get faster. While … By CoinDesk 2025-07-31
ETH Going to $16K in This Cycle? Analyst Explains Why This Could happen Ether ETH hovered near 3,800 on Thursday as increasingly bullish price targets circulated on crypto social media, including one analyst who outlined … By CoinDesk 2025-07-31
Deutsche Bank-backed EURAU stablecoin launch: Key things to know !Deutsche Bank-backed EURAU stablecoin launch Key things to knowimagesnewsdeutsche-bank-backed-eurau-stablecoin-launch-key-t54de4c95fb36.jpg … By Cointelegraph 2025-07-31
Clearpool Expands to Payments Financing, Debuts Stablecoin Yield Token Clearpool, a decentralized credit marketplace, unveiled a suite of products to finance payments, targeting fintech firms processing cross-border … By CoinDesk 2025-07-31
The Ether Machine Becomes Third Largest Ethereum Holder With $56.9M ETH Buy The newly formed companys ETH holdings have overtaken those of the Ethereum Foundation, which maintains the blockchain. By Decrypt 2025-07-31
99% of CFOs plan to use crypto long term, 23% within two years: Deloitte !99 of CFOs plan to use crypto long term, 23 within two years Deloitteimagesnews99-of-cfos-plan-to-use-crypto-long-term-23-within-809de040f0fe.jpg A … By Cointelegraph 2025-07-31
From islands to highways: How blockchain interoperability is finally catching up !From islands to highways How blockchain interoperability is finally catching … By Cointelegraph 2025-07-31
CoinDesk Indices and SGX Indices launch iEdge CoinDesk Cryptocurrency Indices CoinDesk Indices announced, in partnership with SGX Indices, the launch of the iEdge CoinDesk Cryptocurrency … By CoinDesk 2025-07-31
CoinDesk 20 Performance Update: Hedera (HBAR) Gains 7.9% as All Assets Climb Higher CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-07-31
BTC Faces Golden Fibonacci Hurdle at $122K, XRP Holds Support at $3 This is a daily analysis of top tokens with CME futures by CoinDesk analyst and Chartered Market Technician Omkar Godbole. Bitcoin Golden Ratio Eyed … By CoinDesk 2025-07-31
GOAT Network Bets on Fast ZK Proofs to Capture Bitcoin Layer 2 Yield By running proofs in parallel, GOAT Network claims the testnet can resolve transactions in under three seconds. By Decrypt 2025-07-31
Grayscale Launches Trust for Story Protocol to Tap Into $80T Intellectual Property Market Grayscale has launched a new investment vehicle that gives accredited investors exposure to Story, a blockchain protocol designed to turn … By CoinDesk 2025-07-31
Tether-Focused Blockchain Stable Raises $28M to Power Stablecoin Payments Stable, developer of a new blockchain built around Tethers USDT, said it raised 28 million in a seed round led by Bitfinex and Hack VC. Other backers … By CoinDesk 2025-07-31
CoinDCX Employee Arrested Over $44M Exchange Hack Police said hackers duped the employee into installing malware on his office computer using a fake freelance job offer. By Decrypt 2025-07-31
Filecoin Jumps 2% After Defending Support at $2.38 Level Filecoin FIL rose as much as 2 in the last 24-hours after defending key support at the 2.38 level, according to CoinDesk Researchs technical analysis … By CoinDesk 2025-07-31
Corporate crypto treasury holdings top $100B as Ether buying accelerates !Corporate crypto treasury holdings top 100B as Ether buying acceleratesimagesnewscorporate-crypto-treasury-holdings-top-100b-as-eth117c5b041b47.jpg … By Cointelegraph 2025-07-31
BONK Rallies 8% Ahead of Trillion-Token Burn Milestone BONK recorded a notable 8.39 increase rising from 0.000028 to 0.000029httpswww.coindesk.compricebonk, marking a continuation of the tokens bullish … By CoinDesk 2025-07-31
ICP Rises 5% as Token Burn, AI-Powered Development Tools Fuel Rally Internet Computer Protocols native token, ICP, advanced 5 to 5.57 over the last 24 hourshttpswww.coindesk.compriceinternet-computer, bolstered by a … By CoinDesk 2025-07-31
South Korea to target leveraged crypto lending services with new rules !South Korea to target leveraged crypto lending services with new rulesimagesnewssouth-korea-to-target-leveraged-crypto-lending-serb03fcbfd7b9d.jpg … By Cointelegraph 2025-07-31
Algeria Bans All Crypto Activities, Including Ownership and Mining Violations of the new law could incur prison sentences of up to a year, and thousands of dollars in fines. By Decrypt 2025-07-31
‘Everything is fine’: Coinbase mocks UK financial system in new video !Everything is fine Coinbase mocks UK financial system in new videoimagesnewseverything-is-fine-coinbase-mocks-uk-financial-sysd2a5065c1cde.jpg … By Cointelegraph 2025-07-31
Bitcoin Shakes Off Powell Jitters: Crypto Daybook Americas By Omkar Godbole All times ET unless indicated otherwise The crypto market quickly recovered from the late Wednesday swoon triggered by Fed Chair … By CoinDesk 2025-07-31
Germany’s AllUnity Launches BaFin-Regulated Euro Stablecoin EURAU AllUnity, a joint venture between DWS, Galaxy and Flow Traders, has launched EURAU, a euro-denominated stablecoin approved under Germanys new crypto … By CoinDesk 2025-07-31
NEAR Protocol Surges on Institutional Buying, Recovers 8% from Key Support Zone NEAR Protocol demonstrated formidable resilience during the July 30-31 trading session, recovering sharply from mid-session lows of 2.52 to close at … By CoinDesk 2025-07-31
Philippines to secure government documents on Polygon despite network outage !Philippines to secure government documents on Polygon despite network … By Cointelegraph 2025-07-31
Whale Activity Surges as Bitcoin Builds Momentum Toward New Highs Bitcoin BTC is witnessing a notable resurgence in accumulation activity across all investor cohorts, with whale wallets leading the charge. According … By CoinDesk 2025-07-31
'Real fun starts' if XRP price ends July above $3, new analysis says !Real fun starts if XRP price ends July above 3, new analysis saysimagesnewsreal-fun-starts-if-xrp-price-ends-july-above-3-new8424cbfde5ed.jpg XRP … By Cointelegraph 2025-07-31
CoinDCX employee arrested in connection with $44M crypto hack: Report !CoinDCX employee arrested in connection with 44M crypto hack Reportimagesnewscoindcx-employee-arrested-in-connection-with-44m-c83ca0bf38243.jpg … By Cointelegraph 2025-07-31
Bitcoin miner Phoenix Group launches $150M crypto treasury for BTC, SOL !Bitcoin miner Phoenix Group launches 150M crypto treasury for BTC, SOLimagesnewsbitcoin-miner-phoenix-group-launches-150m-crypto-t1eec8d3c5cf1.jpg … By Cointelegraph 2025-07-31
Bitcoin price retargets $119K as treasuries buy 28K BTC in two days !Bitcoin price retargets 119K as treasuries buy 28K BTC in two daysimagesnewsbitcoin-price-retargets-119k-as-treasuries-buy-28k2105356ab33a.jpg … By Cointelegraph 2025-07-31
South Korea Flags Upbit and Bithumb's Crypto Lending, Margin Trading Services Tighter rules may push users offshore, weakening oversight and exposing them to higher risks, Decrypt was told. By Decrypt 2025-07-31
Rice Robotics to Debut RICE Token for AI Data Marketplace on TokenFi Launchpad Rice Robotics, the company behind the RICE AI platform, said it will start selling its RICE token on Aug. 5 via the TokenFi Launchpad. RICE will … By CoinDesk 2025-07-31
Crypto Exchange Kraken's Earnings Fell 6.8% Year-Over-Year to $79.7M in Q2 Cryptocurrency exchange Krakens income in Q2 2025 was 6.8 lower than in the equivalent quarter one year ago. The San Francisco, California-based … By CoinDesk 2025-07-31
NFT sales surge to $574 million in July, second-highest in 2025 !NFT sales surge to 574 million in July, second-highest in 2025imagesnewsnft-sales-surge-to-574-million-in-july-second-highcb6e5ce008fd.jpg … By Cointelegraph 2025-07-31
The Ether Machine buys 15K ETH in $57M purchase, holdings top 334K !The Ether Machine buys 15K ETH in 57M purchase, holdings top 334Kimagesnewsthe-ether-machine-buys-15k-eth-in-57m-purchase-holcaf5a42b172e.jpg The … By Cointelegraph 2025-07-31
The Ether Machine Kicks Off $463M ETH Treasury Strategy With $57M Purchase The Ether Machine, a crypto infrastructure firm preparing to go public via a merger with SPAC sponsor Dynamix, said it executed its first major ether … By CoinDesk 2025-07-31
MicroStrategy's Market Hints at Strongest Downside Risk Since April As shares in Nasdaq-listed MicroStrategy MSTR continue to lose ground, demand for downside protection in the bitcoin-holding company has reached its … By CoinDesk 2025-07-31
Ether, a ‘90s tech stock’ ends July with biggest gain in 3 years !Ether, a 90s tech stock ends July with biggest gain in 3 yearsimagesnewsether-a-90s-tech-stock-ends-july-with-biggest-gain2f9a9a7d67ed.jpg Ether … By Cointelegraph 2025-07-31
Tourists Can Now Withdraw Cash With USDT via Kaia ATMs in South Korea Stablecoin ATMs launch in South Korea for tourists, as regulators continue to weigh rules on broader stablecoin use. By Decrypt 2025-07-31
Donald Trump to get on with Bitcoin reserve ‘in short order’ — Bo Hines !Donald Trump to get on with Bitcoin reserve in short order Bo Hinesimagesnewsdonald-trump-to-get-on-with-bitcoin-reserve-in-shod85a6cfef8ec.jpg … By Cointelegraph 2025-07-31
Crypto class actions on pace to nearly double in 2025 !Crypto class actions on pace to nearly double in 2025imagesnewscrypto-class-actions-on-pace-to-nearly-double-in-25953474ee047.jpg Crypto-related … By Cointelegraph 2025-07-31
Bolivia Looks to El Salvador for Help Building Its Crypto Regulatory Framework On Wednesday, Bolivias central bank announcedhttpswww.bcb.gob.bowebdocsfilesnoticiasCP-3020BCB20-20Acuerdo20BCB20CNAD20OK.pdf that it had signed a … By CoinDesk 2025-07-31
Ethereum activity may top 2024 as it stays key to DeFi, NFTs: DappRadar !Ethereum activity may top 2024 as it stays key to DeFi, NFTs DappRadarimagesnewsethereum-activity-may-top-2024-as-it-stays-key-to-d9d4bf032a35.jpg … By Cointelegraph 2025-07-31
Bitcoin, XRP, Ether Recoup Overnight Losses as Analysts Point to Growing Threat to Fed Independence Major cryptocurrencies have reversed overnight losses, with analysts asserting that Wednesdays Fed decision underscored President Trumps growing … By CoinDesk 2025-07-31
Slower bull market ahead? September Fed rate cut chance falls to 40% !Slower bull market ahead? September Fed rate cut chance falls to 40imagesnewsslower-bull-market-ahead-september-fed-rate-cut-ch9a069a038397.jpg … By Cointelegraph 2025-07-31
Spot Ether ETF staking could ‘dramatically reshape the market’ !Spot Ether ETF staking could dramatically reshape the marketimagesnewsspot-ether-etf-staking-could-dramatically-reshape-7aea388fc8c7.jpg Hank Huang, … By Cointelegraph 2025-07-31
Bolivia calls crypto ‘reliable alternative’ to fiat in El Salvador partnership !Bolivia calls crypto reliable alternative to fiat in El Salvador … By Cointelegraph 2025-07-31
Cboe BZX Seeks Regulatory Nod for Invesco Galaxy's Solana ETF Cboe BZX filed to list a Solana ETF on Wednesday, advancing a second U.S. staking-enabled fund even as the SEC delays on similar products. By Decrypt 2025-07-31
Crypto users warned as ads push malware-laden crypto apps !Crypto users warned as ads push malware-laden crypto appsimagesnewscrypto-users-warned-as-ads-push-malware-laden-crypb21f00fb3442.jpg Over 10 … By Cointelegraph 2025-07-31
Privacy Takes Center Stage in Closing Arguments at Tornado Cash Developer Roman Storm's Trial U.S. prosecutors argued that Tornado Cashs emphasis on privacy wasnt about protecting ordinary users, but about making bags of money. By Decrypt 2025-07-31
Bitcoin Rangebound as Market Ignores Good News in 'Textbook Late Cycle Behavior' Bitcoin trades in a tight range despite bullish catalysts, as analysts warn of late-cycle fatigue and rising risks. By Decrypt 2025-07-31
From Metaverse to Machine Learning, Inside Meta’s $72 Billion AI Gamble During its annual Q2 earnings call, Meta CEO Mark Zuckerberg doubled down on AI, chasing superintelligence for everyone. By Decrypt 2025-07-31
US Exchanges Ask SEC to Consider Rule Change to Speed Up Crypto ETFs Cboe and NYSE Arca have filed proposals that would allow exchanges to list crypto ETFs in a similar way to existing standards in TradFi. By Decrypt 2025-07-31
Asia Morning Briefing: MSFT, Meta Soar on Strong AI Earnings, But Crypto AI Tokens Fail to Follow Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-07-31
Robinhood crypto revenue doubles as CEO bets big on asset tokenization !Robinhood crypto revenue doubles as CEO bets big on asset tokenizationimagesnewsrobinhood-crypto-revenue-doubles-as-ceo-bets-big-o8ad3d9ed7f31.jpg … By Cointelegraph 2025-07-31
High School Student's ChatGPT Trading Bot Is Crushing the Russell 2000 Nathan Smiths AI-built portfolio is up 23.8 in four weeks after leveraging ChatGPT. He shares his take on micro-caps, risk, and Python. By Decrypt 2025-07-31
How Etherex Plans to Fuel Linea's Quest to Boost Ethereum Capital A new decentralized exchange on Ethereum layer-2 network Linea aims to fulfill the original promise of ETH DEXs. By Decrypt 2025-07-31
Bitcoin and Ethereum Aren’t Ready For Quantum Computers, Researcher Says Mysten Labs claims newer blockchains are ready for quantum computing, but older networks risk being left behind. By Decrypt 2025-07-30
Kraken's Q2 earnings dip as exchange expands beyond crypto !Krakens Q2 earnings dip as exchange expands beyond cryptoimagesnewskraken-s-q2-earnings-dip-as-exchange-expands-beyon58e7ea202a44.jpg As Kraken eyes … By Cointelegraph 2025-07-30
Tornado Cash co-founder faces jury after closing arguments wrap !Tornado Cash co-founder faces jury after closing arguments wrapimagesnewstornado-cash-co-founder-faces-jury-after-closing-a4725612f84e7.jpg If … By Cointelegraph 2025-07-30
Bitcoin App Samourai Founders Face 5 Years in Prison Following Guilty Plea The two crypto developers changed their pleas this week. By Decrypt 2025-07-30
Trump's Top Crypto Guys: U.S. DeFi Will Thrive, Assures Bitcoin Reserve Is Coming President Donald Trumps crypto working group finally issued its massive … By CoinDesk 2025-07-30
Trump White House releases long-promised crypto report !Trump White House releases long-promised crypto reportimagesnewstrump-white-house-releases-long-promised-crypto-re49b3124818d3.jpg The report … By Cointelegraph 2025-07-30
Fundamental Global sinks 13% following Ether treasury news !Fundamental Global sinks 13 following Ether treasury newsimagesnewsfundamental-global-sinks-13-following-ether-treasufcdb9dda5574.jpg Markets … By Cointelegraph 2025-07-30
Crypto Bulls Get Hit With $200M in Liquidations as Powell Rattles Market With Fed Warning Crypto markets saw a rise in volatility on Wednesday as Federal Reserve Chair Jerome Powells hawkish remarks rattled leveraged traders. Liquidations … By CoinDesk 2025-07-30
Crypto Scammer Gets Prison Time for Swiping NFTs, Coins via Hacked X Accounts A 22-year-old cybercriminal is going to prison after making nearly 800K by hijacking prominent X accounts to share NFT-swiping scams. By Decrypt 2025-07-30
ETH chart divergence flashes warning while onchain metric predicts rally to $4.5K !ETH chart divergence flashes warning while onchain metric predicts rally to … By Cointelegraph 2025-07-30
Treasury companies solve Ether's narrative problem — Bitwise exec !Treasury companies solve Ethers narrative problem Bitwise execimagesnewstreasury-companies-solve-ether-s-narrative-problem34ea87af7838.jpg Equity … By Cointelegraph 2025-07-30
Samourai Wallet Devs Plead Guilty to Conspiring to Run Unlicensed Money Transmitter The developers of Bitcoin mixing service Samourai Wallet pleaded guilty to one count each of conspiracy to operate an unlicensed money transmitting … By CoinDesk 2025-07-30
Cboe, NYSE Arca move to streamline crypto ETF listings with SEC rule change request !Cboe, NYSE Arca move to streamline crypto ETF listings with SEC rule change … By Cointelegraph 2025-07-30
Robinhood Q2 Earnings Beat Expectations as Crypto Volumes Climb and Bitstamp Deal Pays Off Robinhood HOOD on Wednesday reportedhttpswww.sec.govArchivesedgardata1783879000178387925000250q22025robinhoodexhibit991.htm a 98 year-over-year jump … By CoinDesk 2025-07-30
Ethereum Turns 10: What's Coming in the Next Decade? Ethereum is set to undergo a spree of upgrades and battle quantum computing, as advocates see it becoming the base layer of the future global economy. By Decrypt 2025-07-30
Robinhood Beats Q2 Expectations Despite Sagging Crypto Revenue Crypto trading revenue fell sequentially to 160 million from 252 million. By Decrypt 2025-07-30
Jury Set to Begin Deliberations as Roman Storm’s Money Laundering Trial Draws to Close NEW YORK A Manhattan jury will soon begin their deliberations in Roman Storms trial, deciding whether the Tornado Cash developer is guilty of … By CoinDesk 2025-07-30
Polygon Foundation Links Network Outage to 'Validator Exit' A node issue disrupted the network for 11 hours in 2022. By Decrypt 2025-07-30
Bitcoin makes ‘big move’ after Fed rate decision, Coinbase Premium turns red !Bitcoin makes big move after Fed rate decision, Coinbase Premium turns … By Cointelegraph 2025-07-30
White House Wants Americans to Report, Pay Taxes on Foreign Crypto Accounts The proposal was one recommendation featured in a 168-page digital assets report published by the Trump administration on Wednesday. By Decrypt 2025-07-30
Bitcoin Tumbles Below $116K as Jerome Powell Delivers Hawkish Remarks Did U.S. Federal Reserve Chairman Jerome Powell just threaten to hike rates? At his post-meeting press conference following the Feds Wednesday … By CoinDesk 2025-07-30
Ethereum 2035: How the next 10 years might look !Ethereum 2035 How the next 10 years might lookimagesnewsethereum-2035-how-the-next-10-years-might-lookda2adf270a65.jpg As Ethereum turns 10, leaders … By Cointelegraph 2025-07-30
Will Ethereum Hit a New All-Time High This Year? Odds Favor Bulls: Analysis As ETH flirts with 3,800, traders on Myriad are increasingly bullish that Ethereum finally breaks its all-time high after almost four years. By Decrypt 2025-07-30
Bitcoin Holds Steady as Fed Leaves Interest Rate Intact Crypto markets have largely shrugged off tensions between the White House and U.S. central bank about monetary policy. By Decrypt 2025-07-30
Fed Holds Rates Steady as Expected, but Two Dissent From Decision As was almost universally expected, the U.S. Federal Reserve Wednesday left its benchmark fed funds rate range steady at 4.25-4.5. In a rare … By CoinDesk 2025-07-30
Price predictions 7/30: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, XLM, SUI !Price predictions 730 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, XLM, SUIimagesnewsprice-predictions-7-30-btc-eth-xrp-bnb-sol-doge-ad3a5e0a4144f2.jpg … By Cointelegraph 2025-07-30
Myriad Moves: More Gains for Ethereum? And Can Tornado Cash Dev Roman Storm Avoid Prison? Predictors on Myriad are testing their knowledge on the Roman Storm trial, the price of Ethereum, and how many birds will fly over Texas. By Decrypt 2025-07-30
Trump’s crypto working group pushes for clearer rules as adoption grows !Trumps crypto working group pushes for clearer rules as adoption growsimagesnewstrumps-crypto-working-group-pushes-for-clearer-rul4c18933adf75.jpg … By Cointelegraph 2025-07-30
Fed rate decision incoming: Would a surprise cut send Bitcoin to $140K? !Fed rate decision incoming Would a surprise cut send Bitcoin to 140K?imagesnewsfed-rate-decision-incoming-would-a-surprise-cut-se316d1d3a5dc4.jpg … By Cointelegraph 2025-07-30
Planck launches layer-0 blockchain for artificial intelligence !Planck launches layer-0 blockchain for artificial intelligenceimagesnewsplanck-launches-layer-0-blockchain-for-artificial-a2c9054c779b.jpg Planck … By Cointelegraph 2025-07-30
The Protocol: Ethereum Turns Ten Welcome to The Protocol, CoinDesks weekly wrap-up of the most important stories in cryptocurrency tech development. Im Margaux Nijkerk, CoinDesks … By CoinDesk 2025-07-30
Indian Production Company Faces Backlash for Releasing AI Altered Film Without Director’s Consent Film studio Eros used AI to create new ending for 2013 movie without directors consent, igniting debate over artistic integrity and AI ethics. By Decrypt 2025-07-30
Coinbase, JPMorgan Deal Signals Shift in Institutional Posture Towards Crypto: Bernstein Coinbase COIN and JPMorgan JPM have formed a long-term strategic … By CoinDesk 2025-07-30
Polygon Hemidall mainnet experiences temporary outage !Polygon Hemidall mainnet experiences temporary outageimagesnewspolygon-hemidall-mainnet-experiences-temporary-outaea41178c361.jpg The Bor layer, … By Cointelegraph 2025-07-30
ATOM Plunges 4% as Bearish Momentum Accelerates ATOM tumbled 3.7 in the 24-hour session ending July 30 at 1400 GMT, falling from 4.60 to 4.43 under intense selling pressure. The most aggressive … By CoinDesk 2025-07-30
Ethereum Could Win the War, But Lose the Prize Over the past decade, Ethereum has become the foundation of on-chain finance. It introduced programmable money, enabled the tokenization of … By CoinDesk 2025-07-30
NEAR Inches Higher in Final Hour as DeFi Catalysts Clash With Bearish Momentum NEAR Protocol NEAR staged a modest intraday recovery during the final 60 minutes of trading on July 30, inching from 2.62 to a session high of 2.63 … By CoinDesk 2025-07-30
Ethereum Treasury Firm BTCS Aims to Raise Up to $2B in Ether Buying Power BTCS BTCS, a Nasdaq-listed blockchain infrastructure and staking company focused on Ethereum, … By CoinDesk 2025-07-30
DoubleZero Launches $537M SOL Stake Pool to Turbocharge Solana Validator Network DoubleZero, the decentralized protocol built to accelerate blockchain performance, has unveiled a new 3 million SOL stake pool, worth about 537 … By CoinDesk 2025-07-30
Twenty One Boosting Bitcoin Holdings; CEO Jack Mallers Sees $150K BTC Incoming Twenty One Capital, the bitcoin BTC treasury firm backed by Tether and Softbank, plans to add 5,800 BTC to its reserves ahead of a public listing … By CoinDesk 2025-07-30
White House: Sprawling Crypto Report Makes No Mention of Bitcoin Reserve President Trumps January executive order said the report should outline how the federal government should go about creating a national crypto … By Decrypt 2025-07-30
No U.S. Bitcoin Reserve Plans as White House Touts Crypto Report The long-awaited White House crypto strategy is out, but the 163-page report … By CoinDesk 2025-07-30
"A Whale of a Problem: Why Self-Custody Might Sink Bitcoin Giants" For over a decade, the mantra for bitcoin holders has been clear not your keys, not your coins. But as bitcoin matures into a globally recognized … By CoinDesk 2025-07-30
Shiba Inu Eyes Monthly Gain Despite 8% Price Loss Shiba inu SHIB, the worlds second-largest memecoin, has had a rough week. Still, the cryptocurrency appears on track to register a double-digit … By CoinDesk 2025-07-30
Bitcoin Miner MARA Is Missing Out on AI Boom: Compass Point The Bitcoin miner owns 50,000 BTC worth 5.8 billion. By Decrypt 2025-07-30
Alleged XRP Thief Also Accused of Stealing Ethereum, SHIB From George Jones' Widow Nancy Jones, the widow of country music legend George Jones, accused a man of stealing other crypto assets alongside 17 million in XRP. By Decrypt 2025-07-30
BTC STABLE, SEC ALLOWS IN-KIND REDEMPTIONS, FED DECISION TODAY BTC broadly stable ahead of Fed decision today. SEC allows ETPs to use in-kind mechanisms. eToro launches tokenised US stocks on ETH. Lummis intros … By Decrypt 2025-07-30
Here’s why some Ethereum traders expect ETH price to hit $16K this cycle !Heres why some Ethereum traders expect ETH price to hit 16K this cycleimagesnewsheres-why-some-ethereum-traders-expect-eth-price-t5f4b99185a53.jpg … By Cointelegraph 2025-07-30
BNB Breaks Below $800 as Volume Patterns Point to Lack of Sustained Demand Despite Corporate Interest The price of BNB fell from around 815.8 to 795 in a move that breached the widely watched 800 support level. At its lowest, BNB touched 780 before … By CoinDesk 2025-07-30
Indonesia to Raise Taxes on Crypto Transactions: Reuters Indonesia plans to raise taxes on crypto transactions by Aug. 1 as crypto investing grows more popular, Reuters reported … By CoinDesk 2025-07-30
TON may become the first everyday blockchain by 2027 !TON may become the first everyday blockchain by 2027imagesnewston-may-become-the-first-everyday-blockchain-by-20c12dd1de3ad8.jpg TON, the blockchain … By Cointelegraph 2025-07-30
Dragonfly Capital No Longer Under DOJ Scrutiny In Tornado Cash Trial: Co-Founder Haseeb Qureshi called the original threat unprecedented and a clear violation of DOJ policy designed to prevent defense testimony. By Decrypt 2025-07-30
Backwards-compatible quantum fix found, but not for Bitcoin and Ethereum !Backwards-compatible quantum fix found, but not for Bitcoin and Ethereumimagesnewsbackwards-compatible-quantum-fix-found-but-not-for9125f90fdb28.jpg … By Cointelegraph 2025-07-30
FG Nexus Debuts with $200M Raise and Ether Treasury Strategy on Ethereum's 10th Birthday Nasdaq-listed Fundamental Global FGF is rebranding to FG Nexus and entering the digital asset space with a 200 million private placement to launch an … By CoinDesk 2025-07-30
CoinDesk 20 Performance Update: Bitcoin and Ethereum Trade Flat as Index Declines CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-07-30
Telegram’s @crypto Handle Gets $25M Offer as Price Surges 70-Fold in 2 Years An early Telegram and toncoin TON user received a 25 million offer for the instant-messaging apps crypto username on Wednesday, Telegram CEO Pavel … By CoinDesk 2025-07-30
Telegram Bans $35B Scam Marketplace. Only to See Illicit Crypto Trades Surge Elsewhere In a sweeping crackdown on the socalled Telegram marketplace ecosystem, the messaging giant has banned Huione … By CoinDesk 2025-07-30
Bitcoin, Ethereum, and XRP Slump as US Interest Rate Decision Nears Crypto markets slide 5.4 as Bitcoin, Ethereum, and XRP fall ahead of Fed decision while ETF flows remain strong despite policy uncertainty. By Decrypt 2025-07-30
Trump-linked WLFI invests $10M in Falcon Finance for stablecoin development !Trump-linked WLFI invests 10M in Falcon Finance for stablecoin … By Cointelegraph 2025-07-30
Ethereum at 10: What's Next for the World Computer? When Ethereum launched on July 30, 2015, it set out to be more than just another cryptocurrency. It aimed to expand the boundaries of blockchain … By CoinDesk 2025-07-30
Brazil's VERT Capital to Tokenize $1B in Real-World Assets on XDC Network VERT Capital, a Brazilian credit structuring and securitization firm, plans to tokenize up to 1 billion in debt and receivables on the XDC Network … By CoinDesk 2025-07-30
Polkadot's DOT Drops Over 6% as Deterioration Accelerates DOT fell more than 6 over 24 hours, retreating from 4.02 to 3.77 amid a wider sell-off in crypto markets that saw the broad market CoinDesk 20 index … By CoinDesk 2025-07-30
Ripple’s Schwartz defends low XRPL volume, says banks settle offchain !Ripples Schwartz defends low XRPL volume, says banks settle offchainimagesnewsripples-schwartz-defends-low-xrpl-volume-says-bank3fc088dff5f1.jpg … By Cointelegraph 2025-07-30
Stablecoins add $4B, Bitcoin exchange reserves below 15%: July in charts !Stablecoins add 4B, Bitcoin exchange reserves below 15 July in chartsimagesnewsstablecoins-add-4b-bitcoin-exchange-reserves-belowc2da6771d73a.jpg … By Cointelegraph 2025-07-30
Japan’s crypto tax overhaul: What investors should know in 2025 !Japans crypto tax overhaul What investors should know in 2025imagesnewsjapans-crypto-tax-overhaul-what-investors-should-kb6e46e8cb942.jpg Japan is … By Cointelegraph 2025-07-30
Twenty One Capital eyes Bitcoin-backed USD loans: Report !Twenty One Capital eyes Bitcoin-backed USD loans Reportimagesnewstwenty-one-capital-eyes-bitcoin-backed-usd-loans-rd6fb91378366.jpg Twenty One … By Cointelegraph 2025-07-30
BTC Tentative, Dollar Index Hits 5-Week High as U.S. GDP Grew 3% in Second Quarter Bitcoin BTC traded tentatively below 118,000 after better-than-expected U.S. growth data pushed the dollar index to a five-week high. The dollar … By CoinDesk 2025-07-30
JPMorgan to allow crypto purchases with Coinbase !JPMorgan to allow crypto purchases with Coinbaseimagesnewsjpmorgan-to-allow-crypto-purchases-with-coinbased127b7d58040.jpg Coinbase and JPMorgan … By Cointelegraph 2025-07-30
Base Overtakes Solana in Daily Tokens Created As Pump.fun Continues to Shrink Zora led the way for daily token creations on Monday, accounting for more launches than Solana giants Pump.fun and LetsBonk combined. By Decrypt 2025-07-30
Donald Trump’s ‘Golden Age of Crypto’ Takes Shape With White House Working Group Report Donald Trumps cryptocurrency-friendly administration is set to usher in Americas golden age of crypto, quickly enabling digital asset trading at the … By CoinDesk 2025-07-30
JPMorgan Teams With Coinbase to Let Users Buy Crypto With Bank Accounts, Points and Cards Wall Street banking giant JPMorgan JPM is teaming with crypto exchange Coinbase COIN to roll out a series of integrations aimed at making it easier … By CoinDesk 2025-07-30
JP Morgan, Coinbase To Enable 'Direct Bank-to-Wallet Connection' for Chase Customers JPMorganChase and Coinbase have signed a deal that will allow customers to buy crypto quicker and easier than before. By Decrypt 2025-07-30
BONK Sinks 12% as Meme Token Sector Faces Heavy Sell-Off BONK experienced a steep 12 drawdown over the last 24 hours, declining from 0.0000317 to 0.0000276httpswww.coindesk.compricebonk, while the broader … By CoinDesk 2025-07-30
Kraken Eyes $500M Fundraise at $15B Valuation Ahead of Potential IPO: Report The crypto exchange plans a fresh capital raise amid a wave of public listings from major names in the industry. By Decrypt 2025-07-30
Ethereum at 10: The top corporate ETH holders as Wall Street eyes crypto !Ethereum at 10 The top corporate ETH holders as Wall Street eyes cryptoimagesnewsethereum-at-10-the-top-corporate-eth-holders-as-wad382f76d89e1.jpg … By Cointelegraph 2025-07-30
Florida Sheriff's Office Forced to Return Seized Crypto After Legal Challenge Volusia Countys crypto seizure from a foreign brokerage was based on a sealed warrant with no case number and no clear fraud link. By Decrypt 2025-07-30
Ethereum turns 10: Here’s how its booms and busts shaped history !Ethereum turns 10 Heres how its booms and busts shaped historyimagesnewsethereum-turns-10-heres-how-its-booms-and-busts-sh619bfb7d092c.jpg From the … By Cointelegraph 2025-07-30
PEPE Falls Nearly 5% as Whale Selling and Exchange Outflows Rattle Memecoin Meme-inspired cryptocurrency PEPE slipped nearly 5 in the last 24-hour period under a wave of liquidations and record-setting trading activity. The … By CoinDesk 2025-07-30
In-Kind Bitcoin and Ether ETFs: How They Will Reshape the Crypto Market? The U.S. Securities and Exchange Commission SEC approval on Tuesday of in-kind creations and … By CoinDesk 2025-07-30
ICP Slips 5% as Key Support Levels Buckle Under Selling Pressure Internet Computer Protocols native token ICP declined 4.77 over the past 24 hours, slipping from 5.66 to … By CoinDesk 2025-07-30
Bank of Korea to Establish Virtual Asset Team as Lee Looks to Shape Crypto Regime: Report South Koreas central bank plans to establish a virtual asset team as it considers its approach to the crypto sector, according to a report by local … By CoinDesk 2025-07-30
‘Wall Street on a blockchain’ isn’t tokenization endgame: Kraken exec !Wall Street on a blockchain isnt tokenization endgame Kraken execimagesnewswall-street-on-a-blockchain-isnt-tokenization-endg7efc33a6e3d3.jpg A … By Cointelegraph 2025-07-30
$3 price at risk? Why XRP was one of the worst performers this week !3 price at risk? Why XRP was one of the worst performers this weekimagesnews3-price-at-risk-why-xrp-was-one-of-the-worst-perfoeade64427c7c.jpg Most … By Cointelegraph 2025-07-30
Hong Kong to begin 6-month transition period for new stablecoin rules !Hong Kong to begin 6-month transition period for new stablecoin rulesimagesnewshong-kong-to-begin-6-month-transition-period-for-nedfb25324887.jpg … By Cointelegraph 2025-07-30
Altcoin Rally Fizzles as Ether Turns 10: Crypto Daybook Americas By Francisco Rodrigues All times ET unless indicated otherwise Bitcoin BTC is holding its own as the broader crypto market declines in the run-up to … By CoinDesk 2025-07-30
Indonesia to Hike Crypto Taxes, Target Offshore Platforms With Higher Rates Next Month The overhaul may simplify onboarding for new investorsbut could also raise barriers for high-frequency trading, Decrypt was told. By Decrypt 2025-07-30
DOJ is not probing Dragonfly over Tornado Cash ties, exec says !DOJ is not probing Dragonfly over Tornado Cash ties, exec saysimagesnewsdoj-is-not-probing-dragonfly-over-tornado-cash-tie7bae15b61f3f.jpg The DOJ … By Cointelegraph 2025-07-30
Boerse Stuttgart’s Crypto Platform Adds Six More Cryptocurrencies for Retail Traders BISON, the crypto trading platform owned by Boerse Stuttgart Group, will add six new cryptocurrencies to its offering by the end of July, bringing … By CoinDesk 2025-07-30
Indonesia raises taxes on crypto exchange sales and miners !Indonesia raises taxes on crypto exchange sales and minersimagesnewsindonesia-raises-taxes-on-crypto-exchange-sales-ana40de20a6417.jpg Indonesias … By Cointelegraph 2025-07-30
WLFI Invests $10M in Falcon Finance to Boost On-Chain Dollar Liquidity Stablecoin project Falcon Finance said it secured a 10 million strategic investment from World Liberty Financial WLFI, the decentralized finance DeFi … By CoinDesk 2025-07-30
Bitcoin in limbo: Watch these BTC price levels ahead of FOMC !Bitcoin in limbo Watch these BTC price levels ahead of FOMCimagesnewsbitcoin-in-limbo-watch-these-btc-price-levels-ahea11984aba72b9.jpg Bitcoin … By Cointelegraph 2025-07-30
XRP Futures Volume on Kraken Eclipses Sol for 1st Time as Price Soars to Record XRP XRP perpetual futures listed on the U.S.-based Kraken exchange have become more popular than their sol SOL counterparts for the first time. … By CoinDesk 2025-07-30
Crypto token unlocks may halve to $3B in August; SUI, FTN top list !Crypto token unlocks may halve to 3B in August SUI, FTN top listimagesnewscrypto-token-unlocks-may-halve-to-3b-in-august-suia13b53b1d468.jpg … By Cointelegraph 2025-07-30
7% dip or $141K breakout? Bitcoin speculators dictate BTC price targets !7 dip or 141K breakout? Bitcoin speculators dictate BTC price targetsimagesnews7-dip-or-141k-breakout-bitcoin-speculators-dictatecff9722a9cee.jpg … By Cointelegraph 2025-07-30
Altseason on horizon amid liquidity surge, regulatory clarity: Sygnum !Altseason on horizon amid liquidity surge, regulatory clarity Sygnumimagesnewsaltseason-on-horizon-amid-liquidity-surge-regulato322f6d020bcc.jpg … By Cointelegraph 2025-07-30
ARK Invest Buys Another $15.3M Worth of Ether Strategy Firm BitMine Immersion ARK Invest increased its investment in ether treasury company BitMine Immersion Technologies for a second straight day, buying 15.3 million worth of … By CoinDesk 2025-07-30
Chinese Exec Jailed for Laundering $19.5M Through Crypto Mixers, Exchanges Prosecutors say the former executive funneled company funds into crypto via false claims, with investigators tracing assets despite obfuscation tools. By Decrypt 2025-07-30
Ethereum Defies Bitcoin Slump as Analysts See Path to $5,000 Ethereum is gaining momentum on ETF inflows, regulatory shifts, and macro tailwinds, with analysts eyeing a breakout toward 5,000. By Decrypt 2025-07-30
AML Bitcoin founder gets 7 years in prison for crypto fraud !AML Bitcoin founder gets 7 years in prison for crypto fraudimagesnewsaml-bitcoin-founder-gets-7-years-in-prison-for-cry43d4145fa6d3.jpg Rowland … By Cointelegraph 2025-07-30
Visa Flags Modest Stablecoin Uptake, Calls for Clear US Regulation Visa sees stablecoins as a long-term opportunity but says adoption remains limited amid regulatory uncertainty and low transaction volumes. By Decrypt 2025-07-30
Bank of Korea to launch virtual asset committee to monitor crypto !Bank of Korea to launch virtual asset committee to monitor cryptoimagesnewsbank-of-korea-to-launch-virtual-asset-committee-toee9222322631.jpg The … By Cointelegraph 2025-07-30
Kraken seeks $500M at $15B valuation ahead of rumoured 2026 IPO: Report !Kraken seeks 500M at 15B valuation ahead of rumoured 2026 IPO Reportimagesnewskraken-seeks-500m-at-15b-valuation-ahead-of-rumour332b0e8fe505.jpg … By Cointelegraph 2025-07-30
Bitcoin Price Awaits Fed Clarity Following Constructive US-China Trade Talks Crypto markets tread water as U.S.-China trade discussions yield no firm breakthrough, with tariff extension talks still unresolved. By Decrypt 2025-07-30
Samourai Wallet co-founders to now plead guilty to US charges !Samourai Wallet co-founders to now plead guilty to US chargesimagesnewssamourai-wallet-co-founders-to-now-plead-guilty-tof137748d944d.jpg Samourai … By Cointelegraph 2025-07-30
MARA Holdings posts Q2 revenue beat with 64% year-on-year jump !MARA Holdings posts Q2 revenue beat with 64 year-on-year jumpimagesnewsmara-holdings-posts-q2-revenue-beat-with-64-year-o62dab711792c.jpg Crypto … By Cointelegraph 2025-07-30
Key player in $13M crypto Ponzi scheme pleads guilty !Key player in 13M crypto Ponzi scheme pleads guiltyimagesnewskey-player-in-13m-crypto-ponzi-scheme-pleads-guilt617d93163580.jpg Vincent Anthony … By Cointelegraph 2025-07-30
Michael Saylor's Strategy Raises $2.5B in Record Stock Offering to Buy More Bitcoin Strategy has raised capital through newly listed preferred shares to purchase another 21,021 BTC, lifting its total stash to nearly 629,000. By Decrypt 2025-07-30
Asia Morning Briefing: SEC's In-Kind BTC, ETH ETF Redemption Shift Happened Years Ago in Hong Kong Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-07-30
AI Browser Wars Heat Up as Microsoft Launches New Copilot Mode on Edge Heres our review of Copilot Mode, an experimental revamp to Microsofts Edge browser that makes it even more AI centric. By Decrypt 2025-07-30
Bitcoin momentum loss is pre-FOMC derisking, not a trend change !Bitcoin momentum loss is pre-FOMC derisking, not a trend changeimagesnewsbitcoin-momentum-loss-is-pre-fomc-derisking-not-a-f10632a70674.jpg Traders … By Cointelegraph 2025-07-30
Strategy buys 21K Bitcoin with 2025’s biggest public offering !Strategy buys 21K Bitcoin with 2025s biggest public offeringimagesnewsstrategy-buys-21k-bitcoin-with-2025s-biggest-publi6ebb9b0ef350.jpg Strategy … By Cointelegraph 2025-07-30
NYM Privacy Token Pumps as UK Demand for VPNs Spikes The Nym token has jumped considerably in the past day as UK VPN demand spikes 6,000 amid a new age verification law. By Decrypt 2025-07-29
Twenty One Boosts Bitcoin Treasury Total to $5.1 Billion—With Help From Tether The firm expects to hold about 43,500 Bitcoin after stablecoin giant said it would provide more digital coins. By Decrypt 2025-07-29
MARA Shares Jump as Q2 Revenue Beats Wall Street's Expectations Thanks to Surging BTC Price Bitcoin miner MARA Holdings MARA shares jumped nearly 4 in post-market trading after the company posted record revenue for its second quarter, … By CoinDesk 2025-07-29
A Pressure Group Forced Steam to Remove Adult Games. It's Coming After Crypto Next Steam dumped adult games following pressure on payment providers. Now, Collective Shout says crypto payment firms could be targeted next. By Decrypt 2025-07-29
eToro to tokenize 100 most popular US stocks on Ethereum !eToro to tokenize 100 most popular US stocks on Ethereumimagesnewsetoro-to-tokenize-100-most-popular-us-stocks-on-et364950f013d4.jpg The company … By Cointelegraph 2025-07-29
'Unleash the Zilla': Biotech Rebrands to ETHZilla, Raising Monster $425M for Ethereum Treasury Another publicly traded firm is starting an Ethereum treasury, hoping to make a Godzilla-sized impact on the growing sector. By Decrypt 2025-07-29
XRP open interest sheds $2.4B: Is a price crash next? !XRP open interest sheds 2.4B Is a price crash next?imagesnewsxrp-open-interest-sheds-2-4b-is-a-price-crash-next6fda3f1050b5.jpg XRP futures data … By Cointelegraph 2025-07-29
Bitcoin Mixer Samourai Founders to Plead Guilty in Crypto Privacy Case The two behind the Bitcoin mixing app had previously pleaded not guilty when the U.S. Department of Justice filed charges against them. By Decrypt 2025-07-29
US Senate bill seeks to include crypto in mortgage approval process !US Senate bill seeks to include crypto in mortgage approval processimagesnewsus-senate-bill-seeks-to-include-crypto-in-mortgage6dc5c9d2c8cb.jpg If … By Cointelegraph 2025-07-29
Tornado Cash Developer Roman Storm Will Not Take the Stand, Lawyers Say NEW YORK Roman Storm, the Tornado Cash developer standing trial in Manhattan on charges that the privacy tool he created helped hackers and other … By CoinDesk 2025-07-29
Tom Lee's Ethereum Treasury BitMine Approves $1 Billion Stock Buyback The largest Ethereum treasury firm, which holds more than 2 billion worth of ETH, announced the repurchase plan that will be open-ended, allowing … By Decrypt 2025-07-29
SEC Approves In-Kind Redemptions for All Spot Bitcoin and Ethereum ETFs The U.S. Securities and Exchange Commission SEC has … By CoinDesk 2025-07-29
SEC Acknowledges BlackRock Staking Request for Ethereum ETF The regulator has extended its decision deadline for similar proposals this year. By Decrypt 2025-07-29
Michael Saylor's Strategy Makes Massive $2.4B Bitcoin Purchase With Preferred Stock Sale Proceeds Strategy MSTR, the largest corporate owner of bitcoin BTC, … By CoinDesk 2025-07-29
Bitcoin ETF Institutional Investors Will Now Be Able to Redeem Shares for BTC The SEC has approved in-kind redemptions for crypto ETFs, enabling a feature sought by Bitcoin and Ethereum fund issuers. By Decrypt 2025-07-29
SEC approves in-kind creations and redemptions for crypto ETPs !SEC approves in-kind creations and redemptions for crypto ETPsimagesnewssec-approves-in-kind-creations-and-redemptions-for5edbb931a11d.jpg SEC Chair … By Cointelegraph 2025-07-29
Samourai Wallet Devs Expected to Plead Guilty to Money Laundering Charges The co-founders of Samourai Wallet are expected to plead guilty to charges that, via their bitcoin mixing service, they helped hackers and other … By CoinDesk 2025-07-29
Bitcoin bulls aim to chase liquidity at $122K, but Q3 seasonality could stall breakouts !Bitcoin bulls aim to chase liquidity at 122K, but Q3 seasonality could stall … By Cointelegraph 2025-07-29
EToro Plans to Tokenize Stocks on Ethereum and Offer 24/7 Trading The trading giant says that using blockchains will help transfer wealth from older generations to younger ones. By Decrypt 2025-07-29
‘A joke in poor taste’: Tornado Cash T-shirt stirs controversy in court !A joke in poor taste Tornado Cash T-shirt stirs controversy in courtimagesnewsa-joke-in-poor-taste-tornado-cash-t-shirt-stirs-co01616c57d744.jpg … By Cointelegraph 2025-07-29
BitMine’s $1B repurchase plan favors shares over more ETH — for now !BitMines 1B repurchase plan favors shares over more ETH for nowimagesnewsbitmines-1b-repurchase-plan-favors-shares-over-more26aedf41907.jpg With … By Cointelegraph 2025-07-29
‘Largest’ volume skew for ETH confirms pivot to altcoins: Glassnode !Largest volume skew for ETH confirms pivot to altcoins Glassnodeimagesnewslargest-volume-skew-for-eth-confirms-pivot-to-altc5569c993fc51.jpg Surging … By Cointelegraph 2025-07-29
Bitcoin price gained 50% the last time its volatility fell this low !Bitcoin price gained 50 the last time its volatility fell this lowimagesnewsbitcoin-price-gained-50-the-last-time-its-volatili230fe8a35983.jpg … By Cointelegraph 2025-07-29
White House steps in to delay CFTC chair vote !White House steps in to delay CFTC chair voteimagesnewswhite-house-steps-in-to-delay-cftc-chair-vote4f7d2f71af16.jpg A vote on prospective CFTC … By Cointelegraph 2025-07-29
Bakkt Sheds Loyalty Division as It Doubles Down on Crypto The firm is selling its loyalty business and raising 75 million as it shifts to crypto custody, trading, and stablecoin infrastructure. By Decrypt 2025-07-29
DOGE, SOL and XRP Lead Altcoin Losses as Rate Jitters and Leverage Unwind Hit Crypto Altcoins slid sharply Tuesday as traders braced for a wave of economic events, including a Federal Reserve interest rate decision due Wednesday. … By CoinDesk 2025-07-29
Down 99%, biotech firm 180 Life Sciences pivots to crypto with ETH bet !Down 99, biotech firm 180 Life Sciences pivots to crypto with ETH betimagesnewsdown-99-biotech-firm-180-life-sciences-pivots-to-c41b7261b688a.jpg … By Cointelegraph 2025-07-29
CRYPTOPUNKS SEE $8.2M IN TRADING VOLUME, CRYPTO MAJORS IN THE RED, PAYPAL ANNOUNCE "PAY WITH CRYPTO" Allocate up to 15 of portfolio to BTC Gold Dalio. Paypal launches multi-crypto payments. Metamask launches stablecoin yield, SOL staking. … By Decrypt 2025-07-29
Why This $500 Million Crypto Treasury Firm Chose BNB Over Bitcoin or Ethereum CEA Industries is building a 500 million crypto treasury by embracing the Binance-launched BNB. Incoming CEO David Namdar explains why. By Decrypt 2025-07-29
Altcoin rally led by ETH, BNB, AVAX, PENGU likely if Bitcoin range break occurs !Altcoin rally led by ETH, BNB, AVAX, PENGU likely if Bitcoin range break … By Cointelegraph 2025-07-29
New Lummis Bill Would Back Effort to Ensure Crypto Assets Can Justify U.S. Mortgages The digital assets industrys most reliable U.S. Senate ally, Cynthia Lummis, has introduced her latest crypto … By CoinDesk 2025-07-29
German Law Creates Loophole for Alleged $2.9M Crypto Theft Judges proved unable to apply German criminal law to a decentralized blockchain transferthough a civil case is still possible. By Decrypt 2025-07-29
NEAR Protocol Retreats 3% Amid Liquidation Cascade NEAR Protocol registered a 3 decline from 2.84 to 2.75 throughout the 24-hour period, with valuations consolidating within a 0.18 bandwidth before … By CoinDesk 2025-07-29
BONK Drops 14% as Institutional Selling Accelerates in Risk-Off Environment BONK, a Solana-based meme token, slid 14 in the last 24 hours, falling from 0.000035 to 0.00003096httpswww.coindesk.compricebonk. The token … By CoinDesk 2025-07-29
Ethereum ‘ready to explode’ as ETH price reclaims $3.8K, analysts say !Ethereum ready to explode as ETH price reclaims 3.8K, analysts sayimagesnewsethereum-ready-to-explode-as-eth-price-reclaims-3-5c3fd2250228.jpg ETH … By Cointelegraph 2025-07-29
Twenty One Capital’s Bitcoin stash is bigger than initially expected !Twenty One Capitals Bitcoin stash is bigger than initially expectedimagesnewstwenty-one-capitals-bitcoin-stash-is-bigger-than-i33bee9c69336.jpg … By Cointelegraph 2025-07-29
EToro Plans to Tokenize U.S. Stocks on Ethereum in Blockchain Push Digital trading platform eToro ETOR shared … By CoinDesk 2025-07-29
Bitcoin slides below $117.5K amid warnings further BTC price drops next !Bitcoin slides below 117.5K amid warnings further BTC price drops nextimagesnewsbitcoin-slides-below-117-5k-amid-warnings-further-c4c738c258ff.jpg … By Cointelegraph 2025-07-29
SharpLink Gaming Drops $780 Million on Ethereum in July The firm has also generated 772 ETH from staking this year. By Decrypt 2025-07-29
PAYPAL EMBRACES CRYPTO, ALTCOIN TREASURIES BEGIN, STOCKS HIT ATH AGAIN Allocate up to 15 of portfolio to BTC Gold Dalio. Paypal launches multi-crypto payments. Metamask launches stablecoin yield, SOL staking. … By Decrypt 2025-07-29
ATOM Plunges 5% Despite Recovery Attempts Amid Bearish Pressure Technical Analysis Shows Mixed Signals ATOM drops 4.51 over 24 hours ending July 29 1100, sliding from 4.88 to 4.66 as recovery bids fail. Cosmos … By CoinDesk 2025-07-29
Bitcoin analysts say this must happen for BTC price to hit new highs !Bitcoin analysts say this must happen for BTC price to hit new highsimagesnewsbitcoin-analysts-say-this-must-happen-for-btc-pric8ca97b10e3c6.jpg … By Cointelegraph 2025-07-29
Hong Kong Releases Guidance on Strict Rules for Stablecoin Issuers The Hong Kong Monetary Authority HKMA released guidance on Tuesday for stablecoin licensing, outlining strict capital, reserve, governance and … By CoinDesk 2025-07-29
Polkadot's DOT Slips 3% as Failed Recovery Attempts Signal Weakness Polkadots DOT dropped more than 3 in the last 24-hours, sliding from 4.09 to 3.96, according to CoinDesk Researchs technical analysis model. Support … By CoinDesk 2025-07-29
Pyth Network brings Hong Kong stock prices onchain for global access !Pyth Network brings Hong Kong stock prices onchain for global accessimagesnewspyth-network-brings-hong-kong-stock-prices-onchain47d7383d1056.jpg … By Cointelegraph 2025-07-29
The GENIUS Act passed and DePIN should be next !The GENIUS Act passed and DePIN should be nextimagesnewsthe-genius-act-passed-and-depin-should-be-nextcf471a5ef56a.jpg The next frontier for crypto … By Cointelegraph 2025-07-29
The Protocol of Agents: Web3’s MCP Potential Starting as an experimental side project at Anthropic, the Model Context Protocol MCP has become the de facto standard for orchestrating agentic … By CoinDesk 2025-07-29
Robinhood Price Target Doubled by JPMorgan on Crypto and Tokenization Bets JPMorgan JPM set its 2026 price target for trading platform Robinhood HOOD to 98, up from 47 in 2025, citing new product launches and acquisition of … By CoinDesk 2025-07-29
Why is India investigating Binance and WazirX over crypto loopholes? !Why is India investigating Binance and WazirX over crypto loopholes?imagesnewswhy-is-india-investigating-binance-and-wazirx-overee79571fb3c5.jpg … By Cointelegraph 2025-07-29
SuperRare $730,000 exploit was easily preventable — Experts weigh in !SuperRare 730,000 exploit was easily preventable Experts weigh inimagesnewssuperrare-730000-exploit-was-easily-preventable-ex8f3becf9abe7.jpg A … By Cointelegraph 2025-07-29
ETH Treasury Race Heats Up: BitMine Still Ahead Despite SharpLink's Latest Ether Purchase Ether ETH is holding steady above 3,800, according to CoinDesk Data, as the battle for dominance among corporate ETH treasuries intensifies. On … By CoinDesk 2025-07-29
New Ether Treasury Firm 'ETHZilla' Emerges With $425M Funding and a DeFi Twist Nasdaq-listed biotech firm 180 Life Sciences ATNF is set to rebrand as ETHZilla after securing 425 million in private funding to pivot toward an … By CoinDesk 2025-07-29
Why Tokenized Stocks are Important: A Breakdown Why Tokenized Stocks are important A Breakdown Crypto Tokenization kraken Decrypt spoke to Krakens global head of consumer, Mark Greenberg, to break … By Decrypt 2025-07-29
Ethereum Treasury Companies Could Buy 10% of All ETH: Standard Chartered ETH treasury firms bought 1 of all Ethereum in just 2 monthsanalyst predicts 10x growth could push prices past 4,000. By Decrypt 2025-07-29
SharpLink Acquired 77K More ETH, Boosting Holdings Over $1.6B SharpLink Gaming SBET, the Nasdaq-listed crypto treasury firm helmed by Ethereum co-founder and ConsenSys CEO Joseph Lubin, … By CoinDesk 2025-07-29
IONOS’ InternetX plans to tokenize 22M domains through Doma Protocol !IONOS InternetX plans to tokenize 22M domains through Doma Protocolimagesnewsionos-internetx-plans-to-tokenize-22m-domains-throbe3b9e05aa69.jpg … By Cointelegraph 2025-07-29
How to use Google Gemini for smarter crypto trading !How to use Google Gemini for smarter crypto tradingimagesnewshow-to-use-google-gemini-for-smarter-crypto-tradin019ef17f558e.jpg Google Gemini Flash … By Cointelegraph 2025-07-29
CoinDesk 20 Performance Update: Stellar (XLM) Gains 2.1% as Index Inches Higher CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-07-29
Corporations have acquired 1% of Ether supply: Standard Chartered !Corporations have acquired 1 of Ether supply Standard Charteredimagesnewscorporations-have-acquired-1-of-ether-supply-stand66f78872fb6f.jpg … By Cointelegraph 2025-07-29
Former SEC official joins Veda as General Counsel amid DeFi expansion !Former SEC official joins Veda as General Counsel amid DeFi expansionimagesnewsformer-sec-official-joins-veda-as-general-counsel-c9497d15798c.jpg … By Cointelegraph 2025-07-29
China’s JD.com registers ‘Jcoin’ ahead of Hong Kong stablecoin regime !Chinas JD.com registers Jcoin ahead of Hong Kong stablecoin regimeimagesnewschinas-jd-com-registers-jcoin-ahead-of-hong-kong-sf3e3ffc1d5f8.jpg … By Cointelegraph 2025-07-29
MARA, Holder of Nearly $6B BTC, Raises $950M to Buy More Bitcoin Bitcoin mining company MARA Holdings MARA has completed a 950 million offering of 0.00 convertible senior notes due … By CoinDesk 2025-07-29
Hong Kong finalizes stablecoin rules, launches public registry !Hong Kong finalizes stablecoin rules, launches public registryimagesnewshong-kong-finalizes-stablecoin-rules-launches-publ82277cc0e9a7.jpg The HKMA … By Cointelegraph 2025-07-29
BitMine Immersion Sets Up to $1B Buyback as Share Price Cools Ether treasury firm BitMine Immersion Technologies BMNR has said it will repurchase up to 1 billion of its outstanding shares as part of a new … By CoinDesk 2025-07-29
Coinbase Reaps Growing Rewards from Circle Ties and USDC Economics: JPMorgan Coinbases COIN partnership with Circle CRCL and exposure to Circles USDC stablecoin is generating significant financial upside, both through equity … By CoinDesk 2025-07-29
ECB Says U.S.-Backed Stablecoin Use in EU Could Weaken Its Monetary Autonomy Widespread use of U.S. dollar-denominated stablecoins in the European Union EU for payments or settlement could damage the European Central Banks … By CoinDesk 2025-07-29
Ethereum Layer-2 Linea Reveals Token Plans, Taps SharpLink and Others for Distribution A LINEA token is coming for Ethereum layer-2 network Linea, with builders promising strong alignment with ETH and the ecosystem. By Decrypt 2025-07-29
Bitcoin's Bollinger Bands Tightest Since February; XRP, SOL Establish Lower Highs This is a daily analysis of top tokens with CME futures by CoinDesk analyst and Chartered Market Technician Omkar Godbole. Bitcoin Bollinger bands … By CoinDesk 2025-07-29
Linea airdrop: 85% to users, builders as L2 seeks Ethereum alignment !Linea airdrop 85 to users, builders as L2 seeks Ethereum alignmentimagesnewslinea-airdrop-85-to-users-builders-as-l2-seeks-ethb10bb8f94870.jpg … By Cointelegraph 2025-07-29
Linea to Burn ETH With Every Transaction in Bold L2 Upgrade Linea, an Ethereum layer-2 network incubated by Consensys, has unveiled a comprehensive suite of upgrades designed to embed the network deeper into … By CoinDesk 2025-07-29
DeFi Dev Boosts Solana Treasury to $218M After Latest Purchase DeFi Development DFDV, the Nasdaq-listed firm pursuing a crypto treasury strategy focused on Solana SOL, said on Tuesday it increased holdings to … By CoinDesk 2025-07-29
Ether Treasury Companies to Eventually Own 10% of Supply: Standard Chartered Corporate treasury participation in ether ETH has surged in recent months, with institutional entities now holding 1 of the cryptocurrencys … By CoinDesk 2025-07-29
CoinDCX Founder Denies Coinbase Acquisition Talks Following $44 Million Hack The exchanges CEO Sumit Gupta stated that CoinDCX is not up for sale, amid talk of a Coinbase acquisition deal. By Decrypt 2025-07-29
ARK Invest Buys the Dip on Ether Strategy Firm BitMine With $18.6M Purchase ARK Invest bought 18.6 million worth of shares in ether treasury firm BitMine Immersion Technologies BMNR. Cathie Woods investment firm added a total … By CoinDesk 2025-07-29
Whale Revives Profit-Taking Concerns as Bitcoin Holds Flat: Crypto Daybook Americas By Omkar Godbole All times ET unless indicated otherwise Bitcoins Asian session bounce from 117,500 ran out of steam near 119,200 during European … By CoinDesk 2025-07-29
Bitmain to open first US-based ASIC chip factory: Bloomberg !Bitmain to open first US-based ASIC chip factory Bloombergimagesnewsbitmain-to-open-first-us-based-asic-chip-factory-bedcf81169734.jpg Leading … By Cointelegraph 2025-07-29
Rakbank becomes the first UAE bank to offer crypto trading for retail !Rakbank becomes the first UAE bank to offer crypto trading for retailimagesnewsrakbank-becomes-the-first-uae-bank-to-offer-crypto7320a7bb9e3b.jpg … By Cointelegraph 2025-07-29
CoinDCX Dismisses Report of Coinbase Acquisition Talks CoinDCX, Indias largest crypto exchange, dismissed a local media report that U.S. rival Coinbase COIN was looking to acquire it. Ignore the rumours, … By CoinDesk 2025-07-29
Bubblemaps flags ‘Rugproof’ launchpad over alleged rug pull risk !Bubblemaps flags Rugproof launchpad over alleged rug pull riskimagesnewsbubblemaps-flags-rugproof-launchpad-over-alleged-rd860282f820c.jpg … By Cointelegraph 2025-07-29
Bitmain Plans Its First U.S. Crypto Mining Facility: Bloomberg Bitmain, one of the largest producers of crypto mining hardware, is set to open its first facility in the U.S. over the next few months, Bloomberg … By CoinDesk 2025-07-29
Arizona Man Pleads Guilty in $13M Crypto Ponzi Scheme, Faces Up to 15 Years The scammers created a fake Federal Crypto Reserve to re-target victims, charging bogus fees to investigate their own scams. By Decrypt 2025-07-29
Cboe files to list staked Injective ETF from Canary Capital !Cboe files to list staked Injective ETF from Canary Capitalimagesnewscboe-files-to-list-staked-injective-etf-from-canar48e66b0862a4.jpg The Cboe has … By Cointelegraph 2025-07-29
Bitcoin price shrugs off potential new $450M Galaxy Digital BTC sale !Bitcoin price shrugs off potential new 450M Galaxy Digital BTC saleimagesnewsbitcoin-price-shrugs-off-potential-new-450m-galaxyf8759db0835a.jpg … By Cointelegraph 2025-07-29
Crypto Fund JellyC Teams Up With Standard Chartered, OKX for Secure Crypto Trading JellyC, a digital asset investment manager with over 100 million in assets under management, said it joined a program with crypto exchange OKX and … By CoinDesk 2025-07-29
D2X Raises $5M to Expand Crypto Derivatives Exchange for Institutions D2X, an Amsterdam-based crypto derivatives exchange designed for institutional investors, has raised 4.3 million euro 5 million in a strategic … By CoinDesk 2025-07-29
UAE Lender RAKBANK Offers Retail Customers Crypto With Bitpanda RAKBANK, one of the oldest lenders in the United Arab Emirates UAE, is allowing retail customers access to cryptocurrencies through a partnership … By CoinDesk 2025-07-29
ARK Invest adds $20M in BitMine, trims Coinbase, Block, Robinhood holdings !ARK Invest adds 20M in BitMine, trims Coinbase, Block, Robinhood … By Cointelegraph 2025-07-29
Rally Stalls for Bitcoin, Ethereum, and XRP—Analysts Split on What’s Next Ethereum shows signs of strength as ETF inflows climb, while Bitcoin and XRP struggle to sustain momentum amid mixed market signals. By Decrypt 2025-07-29
CoinShares Launches Zero-Fee SEI ETP With Staking Yield Across Europe Crypto asset manager CoinShares has launched a new exchange-traded product ETP that gives investors exposure to Sei SEI while eliminating management … By CoinDesk 2025-07-29
US seeks to claim $2.4M in Bitcoin seized from ransomware group !US seeks to claim 2.4M in Bitcoin seized from ransomware groupimagesnewsus-seeks-to-claim-2-4m-in-bitcoin-seized-from-rans2f43482124dc.jpg The US is … By Cointelegraph 2025-07-29
Google search volume for stablecoins hit peak amid ‘parabolic’ growth !Google search volume for stablecoins hit peak amid parabolic growthimagesnewsgoogle-search-volume-for-stablecoins-hit-peak-amidff3375c24809.jpg … By Cointelegraph 2025-07-29
South Korea’s Ruling, Opposition Parties Clash Over Stablecoin Regulation South Koreas rival stablecoin bills hint at a divide over regulation as the country seeks a stronger foothold in the global crypto market. By Decrypt 2025-07-29
Bakkt sells loyalty business to focus on being ‘pure-play crypto’ !Bakkt sells loyalty business to focus on being pure-play cryptoimagesnewsbakkt-sells-loyalty-business-to-focus-on-being-pur438d5c2c0a1e.jpg Bakkt … By Cointelegraph 2025-07-29
CryptoPunks Rally Past $200K Floor for First Time in Over a Year Amid NFT Rebound CryptoPunks floor prices surge amid rising Ethereum, renewed high-value buying, and the NFT markets busiest trading days in months. By Decrypt 2025-07-29
SharpLink’s Joe Lubin wants to buy ETH faster than any other firm !SharpLinks Joe Lubin wants to buy ETH faster than any other firmimagesnewssharplinks-joe-lubin-wants-to-buy-eth-faster-than-17b93f0d8447.jpg … By Cointelegraph 2025-07-29
BitMine tanks 27% despite touting ETH’s implied value at $60K !BitMine tanks 27 despite touting ETHs implied value at 60Kimagesnewsbitmine-tanks-27-despite-touting-eths-implied-valu55dd236b0f66.jpg David Grider, … By Cointelegraph 2025-07-29
Bitcoin Demand Shift: Coinbase's 60-Day BTC Premium Streak Is at Risk After a historic 60-day run, bitcoins BTC premium on Coinbase, a key indicator of robust U.S. investor demand, is dissipating, indicating a notable … By CoinDesk 2025-07-29
Nasdaq-listed Mill City Ventures earmarks $441M toward Sui treasury !Nasdaq-listed Mill City Ventures earmarks 441M toward Sui treasuryimagesnewsnasdaq-listed-mill-city-ventures-earmarks-441m-tow00cb125b390a.jpg Mill … By Cointelegraph 2025-07-29
Tron Inc. Files to Sell Up to $1 Billion in Securities Under TRX Strategy Now called Tron Inc., the toy firm has pivoted into a crypto proxy tied to the Tron blockchain, with Justin Suns father as board chair. By Decrypt 2025-07-29
DOGE Plunges 9% in Steep Sell-Off, but Rebounds From Critical Support Zone What to Know DOGE fell 9.24 from 0.248 to 0.226 during the 24-hour window from July 28 0100 to July 29 0000. Price action swung across a 0.025 range … By CoinDesk 2025-07-29
Coinbase reportedly in advanced talks to buy CoinDCX !Coinbase reportedly in advanced talks to buy CoinDCXimagesnewscoinbase-reportedly-in-advanced-talks-to-buy-coind43633fd4f5d1.jpg Coinbase is … By Cointelegraph 2025-07-29
Canadian vape company jumps 550% in pivot to BNB treasury firm !Canadian vape company jumps 550 in pivot to BNB treasury firmimagesnewscanadian-vape-company-jumps-550-in-pivot-to-bnb-trf5f0bdac0870.jpg CEA … By Cointelegraph 2025-07-29
Billionaire Ray Dalio Backs 15% Allocation to Bitcoin and Gold Amid U.S. Debt Spiral Bridgewater Associates founder Ray Dalio is calling for investors to allocate 15 of their portfolios to bitcoin BTC or gold, citing heightened risks … By CoinDesk 2025-07-29
XRP Accumulation Plan Boosts Hyperscale Data Stock by 12% Shares of Hyperscale Data GPUS rose as much as 12 Monday after the company confirmed it has begun acquiring XRP, following through on its previously … By CoinDesk 2025-07-29
Evolving ETH futures data hints a potential rally to $5K !Evolving ETH futures data hints a potential rally to 5Kimagesnewsevolving-eth-futures-data-hints-a-potential-rally-510c99fef6b3.jpg ETH price … By Cointelegraph 2025-07-29
US Taps Swiss Firm for Massive AI Drone Shipment to Ukraine The Pentagon has tapped Swiss firm Auterion to supply 33,000 AI-guided drone strike kits to Ukraine as the battlefield continues to evolve. By Decrypt 2025-07-29
Asia Morning Briefing: Crypto Rally Stalls, ETH Flows May Decide What Comes Next Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-07-29
Ray Dalio suggests putting 15% in Bitcoin, gold amid US ‘debt doom loop’ !Ray Dalio suggests putting 15 in Bitcoin, gold amid US debt doom loopimagesnewsray-dalio-suggests-putting-15-in-bitcoin-gold-amidc25edafef28b.jpg … By Cointelegraph 2025-07-29
China’s Z.ai Scoffs at US Sanctions, Launches Supercharged AI With $1.5B War Chest Z.ais new open-source models rank third globally, as the firm eyes a Hong Kong IPO and navigates around U.S. export controls. By Decrypt 2025-07-28
SEC Delays Decision on Trump-Linked Bitcoin, Grayscale Solana ETFs The SEC has pushed back its deadline on the Truth Social Bitcoin ETF and Grayscale Solana Trust by several weeks. By Decrypt 2025-07-28
$17 Million in XRP Allegedly Stolen From Widow of Country Music Legend George Jones Kirk West, a former lover of Nancy Joneswidow to George Joneswas arrested Friday in Nashville for the theft of XRP and cash. By Decrypt 2025-07-28
Crypto on deck? Interactive Brokers explores stablecoin launch !Crypto on deck? Interactive Brokers explores stablecoin launchimagesnewscrypto-on-deck-interactive-brokers-explores-stable119f6b179f19.jpg … By Cointelegraph 2025-07-28
Ethereum Treasuries Face Unique Risks Compared to Bitcoin Firms, Says Bernstein Ethereum treasuries are generating staking rewards, but that also presents liquidity and smart contract risks, Bernstein wrote Monday. By Decrypt 2025-07-28
Trump’s Truth Social Bitcoin ETF among multiple crypto funds delayed by SEC !Trumps Truth Social Bitcoin ETF among multiple crypto funds delayed by … By Cointelegraph 2025-07-28
ETH traders predict lower support retest before breakout to $4K !ETH traders predict lower support retest before breakout to 4Kimagesnewseth-traders-predict-lower-support-retest-before-brd994f349814d.jpg ETH … By Cointelegraph 2025-07-28
Bakkt Sells Loyalty Business and Pivots to Pure-Play Crypto, Offers Shares Technology platform Bakkt BKKT is moving to complete its transition into a pure-play crypto infrastructure firm with the planned sale of its loyalty … By CoinDesk 2025-07-28
Quintenz, Trump's Pick as Potential U.S. Crypto Watchdog, Delayed by White House Brain Quintenz, President Donald Trumps pick to take over the Commodity Futures Trading Commission thats anticipated to be the premiere U.S. crypto … By CoinDesk 2025-07-28
Anti-CBDC bill could curb Fed’s power over digital dollar, sponsor says !Anti-CBDC bill could curb Feds power over digital dollar, sponsor saysimagesnewsanti-cbdc-bill-could-curb-feds-power-over-digital-68b696140874.jpg … By Cointelegraph 2025-07-28
Bitcoin Miner MARA Boosts BTC Buying Power With Nearly $1 Billion Raise The miner initially said it would raise 850 million. By Decrypt 2025-07-28
Strategy Now Holds $71 Billion in Bitcoin—These Are Its Biggest Buys How did Michael Saylors firm amass a record stash of Bitcoin? Heres a look back at how Strategy made such massive gains. By Decrypt 2025-07-28
You Can Now Buy NBA Top Shot NFTs From Vending Machines in Japan NBA Top Shot collectibles are now available via Japanese vending machines, expanding their reach into the real world. By Decrypt 2025-07-28
PayPal launches crypto checkout tool, adds support for over 100 tokens !PayPal launches crypto checkout tool, adds support for over 100 tokensimagesnewspaypal-launches-crypto-checkout-tool-adds-support-9dd9b95ed3d0.jpg … By Cointelegraph 2025-07-28
Trump Eyes Moving U.S. Economy Further Into Crypto Via Mortgages, 401(k)s With crypto policy now representing one of President Donald Trumps most concrete … By CoinDesk 2025-07-28
DOJ Seeks Forfeiture of Bitcoin Tied to 'Chaos' Ransomware Group The ransomware group emerged as recently as February, according to a cybersecurity firm. By Decrypt 2025-07-28
SOL bears are gone: Here’s what it takes to send Solana to $260 !SOL bears are gone Heres what it takes to send Solana to 260imagesnewssol-bears-are-gone-heres-what-it-takes-to-send-sol252673b9eb37.jpg SOL looks … By Cointelegraph 2025-07-28
Sui Spotlighted as Nasdaq-Listed Lender Raises $450 Million for Crypto Treasury Mill City Ventures stock is up over 270 since last week. By Decrypt 2025-07-28
SUI Token Drops Nearly 6% After Brief Spike as Stronger U.S. Dollar Pressures Crypto Market SUI, the native token of the Sui blockchain, is down nearly 6 over the past 24 hours, retreating to 4.04 after briefly jumping to 4.44 overnight. The … By CoinDesk 2025-07-28
Price predictions 7/28: SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE !Price predictions 728 SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPEimagesnewsprice-predictions-7-28-spx-dxy-btc-eth-xrp-bnb-sol2dee22048bbe.jpg … By Cointelegraph 2025-07-28
BNB Token Rallies to Record High as CEA Industries Raises $500M for Treasury Strategy BNB, formerly known as Binance Coin and the native token of the BNB Chain, surged to a fresh all-time record early Monday, hitting 860. While it … By CoinDesk 2025-07-28
XRP and Dogecoin Erase Explosive Weekly Gains—Should Traders Worry? XRP price is down more than 12 on the week, and Dogecoin is down even worse. The charts show differing paths for altcoins. Heres why. By Decrypt 2025-07-28
Steam Game Loaded With Malware That Targets Crypto Wallets, Harvests Personal Info PC game Chemia appears to have been removed from Steam after a cybersecurity firm said the game was loaded with crypto-jacking malware. By Decrypt 2025-07-28
Nasdaq-Listed Upexi Secures $500M Equity Line to Expand Solana Treasury Holdings Solana SOL treasury activity continues to draw institutional attention after Nasdaq-listed consumer brand company Upexi Inc. announced a new 500 … By CoinDesk 2025-07-28
How to use cryptocurrency to buy a home in Dubai (legally and safely) !How to use cryptocurrency to buy a home in Dubai legally and safelyimagesnewshow-to-use-cryptocurrency-to-buy-a-home-in-dubai-l7cf070f115d1.jpg … By Cointelegraph 2025-07-28
SEC Delays Decision on Trump-Linked Truth Social Bitcoin ETF Until September The U.S. Securities and Exchange Commission SEC has pushed back its decision on whether to approve an exchange-traded fund ETF proposed by Truth … By CoinDesk 2025-07-28
NEAR Slides 4% After Hitting Resistance, Signaling Bearish Reversal EAR Protocol saw pronounced volatility over the 24-hour period from July 27 at 1500 to July 28 at 1400 UTC, fluctuating within a 5 range between 2.88 … By CoinDesk 2025-07-28
VAPE Stock Skyrockets 700% on $500 Million BNB Crypto Treasury Plan Canadian firm CEA Industrieswhich trades as VAPE on the Nasdaqis up huge after revealing a 500 million raise to start a BNB treasury. By Decrypt 2025-07-28
ATOM Climbs 4% Amid Bullish Momentum and Consolidation Near Key Support Zone Cosmos native token ATOM posted a robust 4 gain over the past 24 hours, surging from 4.78 to 4.89 between July 27 at 1500 and July 28 at 1400 UTC. … By CoinDesk 2025-07-28
Tron Inc. seeks $1B to grow TRX holdings as stock rallies !Tron Inc. seeks 1B to grow TRX holdings as stock ralliesimagesnewstron-inc-seeks-1b-to-grow-trx-holdings-as-stock-ra2be42b36c1df.jpg The former … By Cointelegraph 2025-07-28
Pump.fun Revenue Plummets as Meme Coin Traders Tap Other Launchpads LetsBonk debuted in April, and has continued eating into Pump.funs market share. By Decrypt 2025-07-28
Cathie Wood's ARK partners with SOL Strategies for staking services !Cathie Woods ARK partners with SOL Strategies for staking servicesimagesnewscathie-wood-s-ark-partners-with-sol-strategies-for6ce4242aff84.jpg The … By Cointelegraph 2025-07-28
How high can BNB price go? Market analyst predicts $2K cycle top !How high can BNB price go? Market analyst predicts 2K cycle topimagesnewshow-high-can-bnb-price-go-market-analyst-predicts-db6bd314038f.jpg BNB … By Cointelegraph 2025-07-28
Ethereum Turns 10 — Time to Leave the Trilemma Behind Decentralized systems like the electric grid and the World Wide Web scaled by solving communication bottlenecks. Blockchains, a triumph of … By CoinDesk 2025-07-28
Still Loving My ‘If It Went to Zero’ NFT During the NFT boom of 2021, NFT-aficionados said Id love it even if it went to zero as a tongue-in-cheek countercultural declaration that meaning … By CoinDesk 2025-07-28
BONK Surges 6% as Solana Ecosystem Momentum Sparks Investor Interest BONK has rallied 6, recovering from earlier declines to reach 0.000036. The Solana-native meme coin traded in a wide 12 range, moving between … By CoinDesk 2025-07-28
ALTCOINS LEAD RALLY, US-EU TRADE DEAL, NFTS & MEMECOINS SOAR Crypto rallies on US, EU trade deal. BNB hits another ATH, leads major L1s. Galaxy sells 9b BTC for Satoshi-era investor. ETH ETF inflows continue to … By Decrypt 2025-07-28
Ethereum price headed for $4K showdown: Is this time different? !Ethereum price headed for 4K showdown Is this time different?imagesnewsethereum-price-headed-for-4k-showdown-is-this-time367ebe30ce0e.jpg Ether is … By Cointelegraph 2025-07-28
PayPay Expands Crypto Payments for U.S. Merchants to Cut Cross-Border Fees Digital payments giant PayPal PYPL said it is rolling out a service that lets U.S. merchants accept over 100 … By CoinDesk 2025-07-28
Big brands are sleepwalking when it comes to stablecoins !Big brands are sleepwalking when it comes to stablecoinsimagesnewsbig-brands-are-sleepwalking-when-it-comes-to-stablced550e4eb66.jpg With Amazon and … By Cointelegraph 2025-07-28
Billionaire Ray Dalio Urges Investors to Allocate 15% of Portfolios to Gold and Bitcoin The veteran asset manager advised investors to hedge against macroeconomic risks around rising government debts. By Decrypt 2025-07-28
Stablecoin-Focused Bitcoin Sidechain Plasma Draws $373M in Oversubscribed Token Sale Stablecoin-focused blockchain Plasma has closed its public token sale with 373 million in commitments, more than seven times the 50 million it was … By CoinDesk 2025-07-28
ECB adviser doubts digital euro can match US dollar stablecoins !ECB adviser doubts digital euro can match US dollar stablecoinsimagesnewsecb-adviser-doubts-digital-euro-can-match-us-dolladae95b951c13.jpg The … By Cointelegraph 2025-07-28
Ether Treasuries Target Yield, but Risk Looms, Says Wall Street Broker Bernstein Ether ETH treasury firms are emerging with a new playbook Treat the cryptocurrency not just as a reserve asset, but as yield-generating capital. In … By CoinDesk 2025-07-28
PayPal to Enable Businesses to Accept Bitcoin, Ethereum and Other Cryptocurrencies The payment services giant will allow businesses to accept 100 cryptocurrencies. By Decrypt 2025-07-28
Bitcoin Volatility Alert: VIX's Bullish August Seasonality Points to Big Price Swings Bitcoin BTC volatility bulls may soon get their wish because seasonal patterns in Cboes Volatility Index VIX suggest Wall Street is poised for … By CoinDesk 2025-07-28
DeFi Sector TVL Hits 3-Year High of $153B as Investors Rush to Farm Yields The decentralized finance DeFi market ballooned to a three-year high of 153 billion on Monday, spurred by ETHs ascent toward 4,000 and significant … By CoinDesk 2025-07-28
CoinDesk 20 Performance Update: Avalanche (AVAX) Surges 16.2% as All Assets Rise CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-07-28
Strategy skipped Bitcoin buys last week amid new equity offering !Strategy skipped Bitcoin buys last week amid new equity offeringimagesnewsstrategy-skipped-bitcoin-buys-last-week-amid-new-e6ebb9b0ef350.jpg Michael … By Cointelegraph 2025-07-28
Analyst Says ETH Could Hit $13K as Early as Q4, With $8K as Conservative Target A popular pseudonymous crypto analyst on X known as Wolf has outlined a bullish roadmap for ether, … By CoinDesk 2025-07-28
Mining Profitability Climbed Over 5% in June as Hashrate Fell, BTC Price Rose: Jefferies Bitcoin BTC mining profitability increased 5.3 in June, buoyed by a 1.2 increase in the cryptocurrencys price and a 6.7 drop in the network hashrate, … By CoinDesk 2025-07-28
Sky's Grove Expands to Avalanche With $250M RWA Plan, Partnering With Centrifuge, Janus Grove, a credit protocol in the Sky formerly MakerDAO ecosystem, is expanding to the Avalanche AVAX network with plans to allocate up to 250 million … By CoinDesk 2025-07-28
Avalanche gains $250M RWA boost with Grove, Janus Henderson funds !Avalanche gains 250M RWA boost with Grove, Janus Henderson fundsimagesnewsavalanche-gains-250m-rwa-boost-with-grove-janus-hedce2c9f46567.jpg Grove … By Cointelegraph 2025-07-28
Ethereum Wallet MetaMask Adds Stablecoin Yield With DeFi Giant Aave MetaMask, the Ethereum-based crypto wallet, is offering its users the ability to earn interest on their stablecoins thanks to a new partnership with … By CoinDesk 2025-07-28
Monero ‘economic attack’ receives strong community response !Monero economic attack receives strong community responseimagesnewsmonero-economic-attack-receives-strong-community-r692bbceed45f.jpg Monero is … By Cointelegraph 2025-07-28
Bitcoin and Ethereum ETFs Pull in Record-High $11.2 Billion in July Bitcoin and Ethereum ETFs broke records in July with 11.2 billion monthly inflows, as ETH funds continue to outpace Bitcoin. By Decrypt 2025-07-28
Finance Firm Mill City Ventures to Buy $441M in SUI Tokens, Pivoting to Crypto Treasury Strategy Mill City Ventures III, a publicly traded specialty finance firm, is making a dramatic pivot into crypto with the announcement of a 450 million … By CoinDesk 2025-07-28
Zodia Markets Raises $18.25M to Fuel International Expansion, Stablecoin Payments Zodia Markets, the crypto trading firm majority-owned by Standard Chartered STAN, has raised 18.25 million led by Pharsalus Capital. The Series A … By CoinDesk 2025-07-28
BNB Rises Over 6% Amid U.S.-EU Trade Deal and $610M Corporate Buying BNB rose over 6.6 in the last 24-hour window as a wave of corporate treasury purchases and a recently announced trade … By CoinDesk 2025-07-28
Bitcoin Miner MARA Holdings Upgraded to Overweight at JPMorgan; IREN and Riot Cut to Neutral Wall Street bank JPMorgan reshuffled ratings and price targets on a group of bitcoin miners to begin the week. Updating estimates for the group to … By CoinDesk 2025-07-28
Altcoins AVAX, OP, and WLD Climb As BNB Sets New All-time High Binance Smart Chains native token BNB has hit a new all-time high, as other major altcoins begin to climb. By Decrypt 2025-07-28
On-Chain Games Don’t Have a ‘Secret Sauce,’ YGG’s New Advisor Says Quinn Campbell says the future of on-chain games depends on building a system that can fail fastand learn faster. By Decrypt 2025-07-28
Influencer who coined ‘memecoin supercycle’ sits on $68M profit, data suggests !Influencer who coined memecoin supercycle sits on 68M profit, data … By Cointelegraph 2025-07-28
Bitcoin Seeing Severe Exhaustion of Bullish Momentum This is a daily analysis of top tokens with CME futures by CoinDesk analyst and Chartered Market Technician Omkar Godbole. Bitcoin Correction risks … By CoinDesk 2025-07-28
Solana Co-Founder Calls Meme Coins 'Digital Slop' Despite Token-Fueled Surge Anatoly Yakovenko dismissed meme coins and NFTs as having no intrinsic value in a discussion with Base creator Jesse Pollak. By Decrypt 2025-07-28
OKX Introduces Regulated Crypto Derivatives for Retail Traders in UAE OKX says it is the first global crypto exchange to launch regulated derivatives products for retail traders in the United Arab Emirates UAE, offering … By CoinDesk 2025-07-28
Altcoins Pop as Bitcoin Stalls Near $120K: Crypto Daybook Americas By Omkar Godbole All times ET unless indicated otherwise Bitcoin BTC traded little changed around 120,000, struggling to build on a weekend bounce … By CoinDesk 2025-07-28
Metaplanet adds 780 Bitcoin, now holds 17,132 BTC worth over $2B !Metaplanet adds 780 Bitcoin, now holds 17,132 BTC worth over 2Bimagesnewsmetaplanet-adds-780-bitcoin-now-holds-17132-btc-wo7a514b72d97c.jpg Japanese … By Cointelegraph 2025-07-28
XRP price to $4 next? ‘Most profitable phase’ likely here, says analyst !XRP price to 4 next? Most profitable phase likely here, says analystimagesnewsxrp-price-to-4-next-most-profitable-phase-likely-hfb61e5b4c23d.jpg XRP … By Cointelegraph 2025-07-28
Eigen Labs CEO says ‘critical milestone’ slashes scalability trade-off !Eigen Labs CEO says critical milestone slashes scalability trade-offimagesnewseigen-labs-ceo-says-critical-milestone-slashes-sca068c141cd245.jpg … By Cointelegraph 2025-07-28
Clearmatics' New DeFi Derivatives Let Traders Bet on Anything, but It's Not a Prediction Market Clearmaticshttpswww.coindesk.commarkets20181010blockchain-finance-startup-clearmatics-raises-12-million-in-new-funding, one of the first startups to … By CoinDesk 2025-07-28
Crypto funds see $1.9B inflows as Ether leads weekly gains !Crypto funds see 1.9B inflows as Ether leads weekly gainsimagesnewscrypto-funds-see-1-9b-inflows-as-ether-leads-weeklec6edcf5cb32.jpg Although … By Cointelegraph 2025-07-28
Metaplanet Buys 780 More Bitcoin, Increases Stash to 17,132 BTC Metaplanet 3350 said it bought 780 more bitcoin BTC, bringing its total holdings to 17,132 BTC valued about 2 billion at current prices. The … By CoinDesk 2025-07-28
'Biggest trade deal ever' — 5 things to know in Bitcoin this week !Biggest trade deal ever 5 things to know in Bitcoin this weekimagesnewsbiggest-trade-deal-ever-5-things-to-know-in-bitcoidc1f54e34e39.jpg Bitcoin … By Cointelegraph 2025-07-28
Here is the Bitcoin Price Level That Could be an Attractive Entry Point for BTC Bulls As bitcoin BTC holds near its record highs, traders looking to join the uptrend may be facing a dilemma should they enter now, or wait for a more … By CoinDesk 2025-07-28
Democrats probe housing regulator over considering crypto in mortgages !Democrats probe housing regulator over considering crypto in mortgagesimagesnewsdemocrats-probe-housing-regulator-over-consideringf054027e05e7.jpg A … By Cointelegraph 2025-07-28
Volume Surge Fails to Breach Resistance as DOGE Closes Flat at 23-Cents What to Know DOGE traded within a narrow 0.010 range between 0.234 and 0.244 during the 24-hour session from July 27 at 0300 to July 28 at 0200, … By CoinDesk 2025-07-28
SharpLink buys $295M in ETH — more than all the Ether issued last month !SharpLink buys 295M in ETH more than all the Ether issued last monthimagesnewssharplink-buys-295m-in-eth-more-than-all-the-etherff1607972402.jpg … By Cointelegraph 2025-07-28
ASIC Issues Warning Over Bitget's 'Unlicensed' Crypto Futures Products in Australia ASIC has accused Bitget of targeting Australian investors with unlicensed crypto futures, marking its latest move to rein in platforms. By Decrypt 2025-07-28
Bitcoin Zooms to $120K, ETH Nears $4K as Trump’s EU Tariff Deal Lifts Risk Sentiment Markets kicked off the week with a renewed wave of optimism after U.S. President Donald Trump confirmed a tariff deal with the European Union, … By CoinDesk 2025-07-28
Metaplanet Expands Bitcoin Holdings Again in Steady March Toward 2026 Goal Metaplanet is deepening its bitcoin treasury strategy, using share-linked funding to accelerate fresh purchases. By Decrypt 2025-07-28
Ethereum $6K Christmas Odds Surge as Options Traders Reprice Tail Risk A surge in Ethereum call option activity reflects shifting investor appetite for upside exposure, fueled by macro stability. By Decrypt 2025-07-28
Solana co-founder calls memecoins, NFTs ‘digital slop’ in heated debate !Solana co-founder calls memecoins, NFTs digital slop in heated debateimagesnewssolana-co-founder-calls-memecoins-nfts-digital-sloa6a58bef2634.jpg … By Cointelegraph 2025-07-28
XRP Prints Higher Lows, Tests $3.23 Resistance With Heavy Volume XRP posted modest gains despite intraday volatility, recovering from early lows to close near 3.22 on strong afternoon volumes. Institutional … By CoinDesk 2025-07-28
CZ’s estimated BNB holdings hit $75B as BNB breaks new highs !CZs estimated BNB holdings hit 75B as BNB breaks new highsimagesnewsczs-estimated-bnb-holdings-hit-75b-as-bnb-breaks-n3e4c4dba9785.jpg Binance … By Cointelegraph 2025-07-28
What you share with ChatGPT could be used against you !What you share with ChatGPT could be used against youimagesnewswhat-you-share-with-chatgpt-could-be-used-against-b8c9f8378eed.jpg OpenAI CEO Sam … By Cointelegraph 2025-07-28
Coinbase sues man using a Coinbase-like URL to make money !Coinbase sues man using a Coinbase-like URL to make moneyimagesnewscoinbase-sues-man-using-a-coinbase-like-url-to-mak89e8dabc980f.jpg Coinbase has … By Cointelegraph 2025-07-28
Struggling Japanese AI Firm Turns to Bitcoin via Hong Kong Subsidiary Quantum Solutions is turning to Bitcoin via a Hong Kong subsidiary, joining struggling firms chasing upside through crypto treasury plays. By Decrypt 2025-07-28
Roman Storm asks for $1.5M lifeline as Tornado Cash trial presses on !Roman Storm asks for 1.5M lifeline as Tornado Cash trial presses onimagesnewsroman-storm-asks-for-1-5m-lifeline-as-tornado-cash2c575064de7a.jpg … By Cointelegraph 2025-07-28
Asia Morning Briefing: Trump's E.U. Tariff Deal Holds Bitcoin Near $119K Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-07-28
Will Ethereum Continue to Rally? This Bitcoin OG Is Bullish on ETH Hemi Network co-founder Jeff Garzik has a super long-term view on ETH and isnt worried about so-called Ethereum killers overtaking it. By Decrypt 2025-07-27
Bitcoin nears $120K as analysis predicts 'larger price swings' next !Bitcoin nears 120K as analysis predicts larger price swings nextimagesnewsbitcoin-nears-120k-as-analysis-predicts-larger-price71eeaed35f.jpg Bitcoin … By Cointelegraph 2025-07-27
Tether Gold rides bullion boom as central banks, ETFs rush to accumulate !Tether Gold rides bullion boom as central banks, ETFs rush to accumulateimagesnewstether-gold-rides-bullion-boom-as-central-banks-et4e180121d731.jpg … By Cointelegraph 2025-07-27
Michael Saylor Is Bringing Bitcoin-Backed Money-Market-Style Vehicle to Wall Street: NYDIG Strategy MSTR is pulling off some form of financial alchemy using bitcoin, historically a volatile asset, to create something that looks a lot like … By CoinDesk 2025-07-27
AI Avatars Are Pushing Mega-Dose Magnesium—Doctors Say It’s a Health Risk Experts say viral supplement trends driven by AI on social media could pose dangers to peoples kidneys, heart, and more. By Decrypt 2025-07-27
Crypto isn’t crashing the American dream; it’s renovating it !Crypto isnt crashing the American dream its renovating itimagesnewscrypto-isnt-crashing-the-american-dream-its-renova6dc5c9d2c8cb.jpg The US housing … By Cointelegraph 2025-07-27
What’s Next for Hyperliquid’s HYPE Token? What Wall Street and Analysts Are Saying Michael Saylors controversial bitcoin treasury strategy is no longer fringe its being … By CoinDesk 2025-07-27
This Fake Bitcoin ATM Scheme Has Wasted 4,000 Hours of Scammers' Time Scammers use Bitcoin ATMs to get victims to send money to them, so streamer Kitboga created a receipt that can never be redeemed. By Decrypt 2025-07-27
GENIUS Act to spark wave of ‘killer apps’ and new payment services: Sygnum !GENIUS Act to spark wave of killer apps and new payment services Sygnumimagesnewsgenius-act-to-spark-wave-of-killer-apps-and-new-pacf471a5ef56a.jpg … By Cointelegraph 2025-07-27
Divine Research issues unbacked crypto loans using Sam Altman’s World ID !Divine Research issues unbacked crypto loans using Sam Altmans World IDimagesnewsdivine-research-issues-unbacked-crypto-loans-using6e1238efb640.jpg … By Cointelegraph 2025-07-27
Bitcoin Cash Surges Past $580 as Analysts Predict Breakout Toward $620–$680 Range Bitcoin Cash BCH extended its recent rally on Sunday, rising 5.25 to 583.64 as of 0854 GMT, according to CoinDesk data. The token has now gained 10.5 … By CoinDesk 2025-07-27
$9 Billion Exit by Satoshi-Era BTC Whale Sparks Debate: Are Bitcoin OGs Losing Faith? Bitcoins identity crisis came roaring back into focus this weekend after Galaxy Digital GLXY … By CoinDesk 2025-07-27
Pudgy Penguins denies OpenSea acquisition rumors, focuses on partnerships !Pudgy Penguins denies OpenSea acquisition rumors, focuses on … By Cointelegraph 2025-07-27
Bitcoin OGs ‘faith shaken’ comment stirs heated debate in community !Bitcoin OGs faith shaken comment stirs heated debate in communityimagesnewsbitcoin-ogs-faith-shaken-comment-stirs-heated-deba45d687fc3d90.jpg A … By Cointelegraph 2025-07-27
Bitcoin ‘up year’ is 2026, and the four-year cycle is dead: Bitwise !Bitcoin up year is 2026, and the four-year cycle is dead Bitwiseimagesnewsbitcoin-up-year-is-2026-and-the-four-year-cycle-isac57500db8b5.jpg The … By Cointelegraph 2025-07-27
XRP dip was a ‘healthy correction,’ Ether supply shock: Hodler’s Digest, July 20 – 26 !XRP dip was a healthy correction, Ether supply shock Hodlers Digest, July 20 … By Cointelegraph 2025-07-26
Solo Bitcoin miner scores $373,000 block reward !Solo Bitcoin miner scores 373,000 block rewardimagesnewssolo-bitcoin-miner-scores-373000-block-reward150a60c05cd7.jpg Solo miners successfully … By Cointelegraph 2025-07-26
Crypto Still Seen as 'Risky' Among U.S. Investors Despite Ownership Surging 8x Since 2018: Survey Cryptocurrency may be easier to buy than ever, but most Americans still want no part of it. A new Gallup … By CoinDesk 2025-07-26
A Japanese AI Firm Plans to Buy 3,000 Bitcoin Over Next 12 Months Japanese AI firm Quantum Solutions is set to start investing in bitcoin BTC through its Hong Kong-based subsidiary, GPT Pals Studio, the company said … By CoinDesk 2025-07-26
'Parabolic bull markets and devastating bear markets are over’ — BTC analyst !Parabolic bull markets and devastating bear markets are over BTC … By Cointelegraph 2025-07-26
Bitcoin Hits $1T Realized Cap as Price Holds Above $118K After $9B BTC Sale by Satoshi-Era Whale Bitcoin continues to trade above the 118,000 mark, holding steady after a week of significant institutional developments and a landmark milestone in … By CoinDesk 2025-07-26
Russian Entities Using Kyrgyzstan’s Crypto Industry to Evade Sanctions: Report TRM Labs found that Russia-linked activity accounts for almost all of Kyrgyzstans cryptocurrency industry. By Decrypt 2025-07-26
State of Crypto: The Senate Responds to Clarity Act The Senate Banking Committee has introduced a discussion draft bill for addressing crypto market structure, tackling part of what will overall be a … By CoinDesk 2025-07-26
Coinbase’s Base App Rebrand Sends a Little-Known Token Soaring 440% Amid SocialFi Boom Coinbases rebrand of its Wallet into the Base App httpswww.coindesk.comtech20250717coinbase-wallet-becomes-base-app-in-major-rebrandhas kicked off a … By CoinDesk 2025-07-26
Bitcoin bulls 'in control’ as BTC price rebounds to $118K !Bitcoin bulls in control as BTC price rebounds to 118Kimagesnewsbitcoin-bulls-in-control-as-btc-price-rebounds-to-a53c7e1ee65f.jpg Bitcoin delivers … By Cointelegraph 2025-07-26
BNB Rebounds to $780 After $520M Windtree Buy Commitment, Shows Signs of Stabilizing BNB rose around 0.6 in the last 24 hours, shaking off a recent drop to now trade close to 780. At its peak, the token reached 785.75, bouncing from a … By CoinDesk 2025-07-26
Demographics will 'leapfrog' Bitcoin adoption in Pakistan — Bilal Bin Saqib !Demographics will leapfrog Bitcoin adoption in Pakistan Bilal Bin Saqibimagesnewsdemographics-will-leapfrog-bitcoin-adoption-in-paka6334bac71de.jpg … By Cointelegraph 2025-07-26
SUI Soars 15% as Analysts Predict Breakout to as High as $10 on Surging Momentum Sui SUI rallied 15 on Saturday to 4.23, extending its multi-week surge and outperforming most major cryptocurrencies. The token is now up 13.1 over … By CoinDesk 2025-07-26
Wyoming's Stablecoin Billed as Yield-Bearing Alternative to CBDC Control The Wyoming Stable Token is expected to debut next month, putting a publicly funded twist on the stablecoin sector. By Decrypt 2025-07-26
Winklevoss Claims JPMorgan Halted Gemini Onboarding After Data Access Fees Criticism Tyler Winklevoss, co-founder of the crypto exchange Gemini, claimed that JPMorgan Chase halted its onboarding process for Gemini after he criticized … By CoinDesk 2025-07-26
XRP wallet linked to Chris Larsen still has $9B to sell, analyst warns !XRP wallet linked to Chris Larsen still has 9B to sell, analyst warnsimagesnewsxrp-wallet-linked-to-chris-larsen-still-has-9b-to-ed139d835e44.jpg … By Cointelegraph 2025-07-26
Ethereum ETFs Massively Outpace Bitcoin Funds—Why ETH Demand Is Surging Ethereum ETFs flipped their Bitcoin counterparts this week, adding 1.8 billion in ETH while BTC funds saw a fraction of that tally. By Decrypt 2025-07-26
Wrench attacks drive crypto investors to centralized custodians !Wrench attacks drive crypto investors to centralized custodiansimagesnewswrench-attacks-drive-crypto-investors-to-centraliz42f21801da0c.jpg Wrench … By Cointelegraph 2025-07-26
Japan’s ‘slow’ approval culture stifles crypto adoption: Expert !Japans slow approval culture stifles crypto adoption Expertimagesnewsjapans-slow-approval-culture-stifles-crypto-adopti04c0430079f6.jpg Japans slow … By Cointelegraph 2025-07-26
What happens if Bitcoin reaches $1 million? !What happens if Bitcoin reaches 1 million?imagesnewswhat-happens-if-bitcoin-reaches-1-million7b4e831328a2.jpg A 1-million Bitcoin would upend global … By Cointelegraph 2025-07-26
Tyler Winklevoss claims JPMorgan blocked Gemini over public criticism !Tyler Winklevoss claims JPMorgan blocked Gemini over public criticismimagesnewstyler-winklevoss-claims-jpmorgan-blocked-gemini-ov6eaa72ef5c1c.jpg … By Cointelegraph 2025-07-26
HBAR Surges 12% Following Robinhood Listing, Making it Top Daily Gainer Among Top 20 Hederas HBAR token surged nearly 12 on Friday, climbing to 0.2657 and outperforming every other top-20 cryptocurrency by daily percentage gain, … By CoinDesk 2025-07-26
Spot Ether ETFs log $453M in inflows, extend streak to 16 days !Spot Ether ETFs log 453M in inflows, extend streak to 16 daysimagesnewsspot-ether-etfs-log-453m-in-inflows-extend-streak-4d6342996a62.jpg BlackRocks … By Cointelegraph 2025-07-26
Ether’s ‘extreme euphoria’ on social media could trigger a price plunge !Ethers extreme euphoria on social media could trigger a price plungeimagesnewsethers-extreme-euphoria-on-social-media-could-trigf000b2fbac97.jpg … By Cointelegraph 2025-07-26
Analysts See XRP Hitting $4, Solana $250 as ETF Buzz Builds XRP is regaining investor attention as a wave of ETF-driven optimism and post-lawsuit momentum builds around the token even amid price turbulence … By CoinDesk 2025-07-26
Ripple CTO regrets the time he censored Ozzy Osbourne !Ripple CTO regrets the time he censored Ozzy Osbourneimagesnewsripple-cto-regrets-the-time-he-censored-ozzy-osbou6339437b2e8b.jpg The Ripple … By Cointelegraph 2025-07-26
Tea App That Claimed to Protect Women Exposes 72,000 IDs in Epic Security Fail Tea required users to upload an ID and selfie, supposedly to keep out fake accounts and non-women. Now those documents are in the wild. By Decrypt 2025-07-25
El Salvador’s Bitcoin reserve fails to help the average citizen — NGO exec !El Salvadors Bitcoin reserve fails to help the average citizen NGO execimagesnewsel-salvadors-bitcoin-reserve-fails-to-help-the-avef2bee2020496.jpg … By Cointelegraph 2025-07-25
DOJ Considering Criminal Charges Against Dragonfly Capital Employees for Years-Old Tornado Cash Investments NEW YORK Prosecutors told a federal judge in open court on Friday that they were considering criminally charging certain employees of crypto venture … By CoinDesk 2025-07-25
ETH bulls target $9K: Does the data support the lofty price target? !ETH bulls target 9K Does the data support the lofty price target?imagesnewseth-bulls-target-9k-does-the-data-support-the-loftc3629f10a40d.jpg Ether … By Cointelegraph 2025-07-25
Satoshi-era Bitcoin investor cashes out 80,000 BTC for $9B via Galaxy Digital !Satoshi-era Bitcoin investor cashes out 80,000 BTC for 9B via Galaxy … By Cointelegraph 2025-07-25
XRP Erases Gains Following New Record—Does It Still Have Room to Run? The third biggest digital coin has dropped since setting a record last week. By Decrypt 2025-07-25
Bitcoin Rebounds After Galaxy Completes Sale of $9B BTC From Satoshi-Era Whale Bitcoin BTC rebounded on Friday from its overnight dip below 115,000, back to its familiar range it traded for the past two weeks. The largest crypto … By CoinDesk 2025-07-25
DOJ Is Considering Charging Crypto VC Firm Dragonfly in Connection With Tornado Cash During Tornado Cash developer Roman Storms criminal trial on Friday, federal prosecutors revealed they are considering pursuing criminal charges … By Decrypt 2025-07-25
One of the Biggest Bitcoin Whales in History Just Cashed Out $9 Billion Galaxy said Friday that it conducted a 9 billion Bitcoin sale for a Satoshi-era whale. Heres what we know about the massive exit. By Decrypt 2025-07-25
Bitcoin derivatives data questions the strength of BTC’s $115K support !Bitcoin derivatives data questions the strength of BTCs 115K supportimagesnewsbitcoin-derivatives-data-questions-the-strength-of2ed14b426011.jpg … By Cointelegraph 2025-07-25
Real-time crypto laundering exposes CEX vulnerabilities — Report !Real-time crypto laundering exposes CEX vulnerabilities Reportimagesnewsreal-time-crypto-laundering-exposes-cex-vulnerabil98862d41f237.jpg New data … By Cointelegraph 2025-07-25
Public Keys: Strategy Stretches Bitcoin Raise and BlackRock’s Ethereum ETF Hits Warp Speed Ethereum ETF soars to 10B, MicroStrategy eyes 2.5B Bitcoin spree, and MARA stock tumbles on debt news in this weeks crypto market roundup. By Decrypt 2025-07-25
Crypto Biz: Hive’s Nasdaq moment, Citadel’s tokenization warning and Trump’s Bitcoin bull !Crypto Biz Hives Nasdaq moment, Citadels tokenization warning and Trumps Bitcoin … By Cointelegraph 2025-07-25
Why Won’t PUMP Stop Dumping? Bears Are in Complete Control: Analysis Pump.funs PUMP token has dropped by over 63 since its highly anticipated ICO. Where does it go from here? Heres what the charts say. By Decrypt 2025-07-25
ETH price still on track for $4K even as Bitcoin, altcoins sell-off !ETH price still on track for 4K even as Bitcoin, altcoins sell-offimagesnewseth-price-still-on-track-for-4k-even-as-bitcoin-al29e61df1ee10.jpg Data … By Cointelegraph 2025-07-25
Robert Kiyosaki warns of the risk posed by BTC, gold and silver ETFs !Robert Kiyosaki warns of the risk posed by BTC, gold and silver ETFsimagesnewsrobert-kiyosaki-warns-of-the-risk-posed-by-btc-goled0c0e1904d5.jpg The … By Cointelegraph 2025-07-25
XRP, DOGE, SOL Lead Crypto Selloff, But Altcoin Season Still in Play if This Happens While bitcoin BTC slid only modestly, other major cryptocurrencies tumbled over the past few days, sparking doubt of the durability of the so-called … By CoinDesk 2025-07-25
Drug Company Will Buy Up to $700 Million in BNB After Coin Hits All-Time High Windtree Therapeutics has said it is raising another 520 million to buy up BNB, the fifth-largest digital coin, to put on its balance sheet. By Decrypt 2025-07-25
Dragonfly responds to DOJ scrutiny over Tornado Cash investment, vows to ‘vigorously defend’ itself !Dragonfly responds to DOJ scrutiny over Tornado Cash investment, vows to vigorously defend … By Cointelegraph 2025-07-25
SharpLink Nabs BlackRock Exec Who Helped Launch Bitcoin, Ethereum ETFs BlackRocks crypto head is leaving the financial giant to join Ethereum treasury company SharpLink Gaming as its co-CEO. By Decrypt 2025-07-25
Price predictions 7/25: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, XLM, SUI !Price predictions 725 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, XLM, SUIimagesnewsprice-predictions-7-25-btc-eth-xrp-bnb-sol-doge-ad87d3669e51f0.jpg … By Cointelegraph 2025-07-25
Roman Storm’s team expected to close case next week, developer may still testify !Roman Storms team expected to close case next week, developer may still … By Cointelegraph 2025-07-25
I Went to Chinese Billionaire Justin Sun’s Tron Office in Florida—Here’s What I Found A Florida purveyor of theme park goods is getting a new life thanks to Justin Suns Tron. But you wouldnt know it from the office space. By Decrypt 2025-07-25
Revolut Makes Crypto Staking Available in Hungary After Restricting Services Digital bank Revoluts crypto staking services are once again available for its customers in Hungary after pausing for a couple of weeks, a … By CoinDesk 2025-07-25
Ether Machine taps demand with $1.5B institutional ETH vehicle: Finance Redefined !Ether Machine taps demand with 1.5B institutional ETH vehicle Finance … By Cointelegraph 2025-07-25
XRP’s bull run might have ended at $3.65: Here’s what must happen to save it !XRPs bull run might have ended at 3.65 Heres what must happen to save itimagesnewsxrps-bull-run-might-have-ended-at-3-65-heres-what-021008d57632.jpg … By Cointelegraph 2025-07-25
Tokenized money market funds emerge as Wall Street’s answer to stablecoins !Tokenized money market funds emerge as Wall Streets answer to … By Cointelegraph 2025-07-25
Polkadot's DOT Faces Bearish Pressure Despite Recovery Attempts Polkadots DOT encountered ongoing bearish momentum despite several recovery attempts, fluctuating between 3.87-4.11 throughout the 24-hour timeframe, … By CoinDesk 2025-07-25
Elizabeth Warren: American People Will ‘Pay the Price’ for GENIUS Act The Democratic Senator criticized crypto industry lobbying, drawing comparisons to legislation implicated in the buildup to the 2008 financial crash. By Decrypt 2025-07-25
Weekly Recap: Ethereum’s Comeback Summer Its hard to believe that ETH was languishing at less than 1500 in April. Now its above 3800 again. Ethereums comeback is the story of the summer. … By CoinDesk 2025-07-25
ETH LEADS, MONEY SUPPLY HITS ATH, PUNKS CONTINUE TO SURGE BTC dips as jobs data diminishes Fed rate cut hopes. US crypto inflows surge hit 60b YTD. Strategy increases pref stock offering to 2b. Tokyos … By Decrypt 2025-07-25
BONK Drops 9% From Peak as Exchange Transfers Overwhelm Burn News BONK experienced aggressive volatility over a 24-hour period to end the week, swinging 15 between 0.00003185 and … By CoinDesk 2025-07-25
The centralization crisis threatens data privacy !The centralization crisis threatens data privacyimagesnewsthe-centralization-crisis-threatens-data-privacy74a618878beb.jpg Reliance on centralized … By Cointelegraph 2025-07-25
Strategy Ups Raise for Bitcoin Purchases by $2 Billion The Bitcoin behemoth already holds more than 607,000 Bitcoin. By Decrypt 2025-07-25
Ether-Focused SharpLink Appoints Former BlackRock Executive as Co-CEO SharpLink Gaming SBET, the Nasdaq-listed crypto treasury firm that has recently emerged as one of the largest corporate holders of ether ETH, … By CoinDesk 2025-07-25
Smart contract devs think AI code will make crypto safer despite vibe coding fears !Smart contract devs think AI code will make crypto safer despite vibe coding … By Cointelegraph 2025-07-25
Sharplink hits back at BitMine’s $2B Ether buy with BlackRock hire !Sharplink hits back at BitMines 2B Ether buy with BlackRock hireimagesnewssharplink-hits-back-at-bitmines-2b-ether-buy-with-6987be25d04d.jpg … By Cointelegraph 2025-07-25
Luxury Brokerage Christie's Allows Buyers to Purchase Real Estate With Crypto: NYT Christies International Real Estate has launched a dedicated division to facilitate real estate transactions conducted entirely in cryptocurrency, … By CoinDesk 2025-07-25
Ethereum ETFs Pull In $8.7B in First Year After Almost $5B Rush in Past Two Weeks The first wave of U.S.-listed spot Ethereum exchange-traded funds ETFs has racked up nearly 8.7 million in net inflows in its first year on the … By CoinDesk 2025-07-25
Firedancer will speed up Solana, but it won’t reach full potential !Firedancer will speed up Solana, but it wont reach full potentialimagesnewsfiredancer-will-speed-up-solana-but-it-wont-reach-0772f4f5c137.jpg … By Cointelegraph 2025-07-25
Senator Lummis says US is ‘waking up’ on crypto after historic legislative week !Senator Lummis says US is waking up on crypto after historic legislative … By Cointelegraph 2025-07-25
CoinDesk 20 Performance Update: Solana (SOL) Drops 4.2%, Leading Index Lower CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-07-25
Eric Trump ‘agrees' Ether should be over $8K as Global M2 money soars !Eric Trump agrees Ether should be over 8K as Global M2 money soarsimagesnewseric-trump-agrees-ether-should-be-over-8k-as-globa6ba9bd6e5725.jpg … By Cointelegraph 2025-07-25
Billions in Bitcoin Sold on Exchanges as Liquidations Top $500 Million Bitcoin drops 1.8 as Galaxy Digital and others move 3.7B worth of BTC to exchanges, triggering massive selling pressure and liquidations. By Decrypt 2025-07-25
Vietnam deploys national blockchain for identity and records !Vietnam deploys national blockchain for identity and recordsimagesnewsvietnam-deploys-national-blockchain-for-identity-a3d2340ca3175.jpg Vietnam … By Cointelegraph 2025-07-25
NEAR Rallies 6.9% as Bulls Reclaim Control After Overnight Selloff NEAR Protocol bounced 0.7 between 1110 and 1209 UTC on Thursday, erasing a brief 2.77 dip in a volatile trading window marked by sudden institutional … By CoinDesk 2025-07-25
35 companies now hold at least 1,000 Bitcoin as corporate adoption booms !35 companies now hold at least 1,000 Bitcoin as corporate adoption boomsimagesnews35-companies-now-hold-at-least-1000-bitcoin-as-corb127da2b9681.jpg … By Cointelegraph 2025-07-25
Hong Kong’s OSL Raises $300M to Bring ‘Trusted Access’ to Crypto Ahead of Stablecoin Law Rollout As Hong Kongs new stablecoin law looms, the citys first licensed crypto exchange is raising fresh capital to seize an early advantage. By Decrypt 2025-07-25
Crypto Whale Spends $4.3M on CryptoPunks as NFT Market Cap Climbs 66% in 30 Days A single buyer spent more than 2.9 million on six rare CryptoPunks featuring the coveted hoodie trait, deepening a … By CoinDesk 2025-07-25
Nigeria opens doors to stablecoin firms under regulatory oversight !Nigeria opens doors to stablecoin firms under regulatory oversightimagesnewsnigeria-opens-doors-to-stablecoin-firms-under-regu83386e25cd44.jpg … By Cointelegraph 2025-07-25
Off the Grid Skin Sale Volume Nears $30K as the Avalanche Shooter Hits OpenSea Players can now export their Off the Grid skins to sell on the NFT marketplace OpenSea, available to anyone to buy. By Decrypt 2025-07-25
Michael Saylor Builds Out Own Yield Curve With Upsized Preferred Stock Sale Disclaimer The analyst who wrote this article owns shares in Strategy. Strategy MSTR, under the leadership of Executive Chairman Michael Saylor, may … By CoinDesk 2025-07-25
Public Shell Firms Ramping Up Altcoin Buys Draws Skepticism: FT A number of public companies may be about to build hoards of altcoins in an attempt to pump their share prices. Such companies are attempting to … By CoinDesk 2025-07-25
XRP issuer Ripple sees its RLUSD stablecoin grow among retail users !XRP issuer Ripple sees its RLUSD stablecoin grow among retail usersimagesnewsxrp-issuer-ripple-sees-its-rlusd-stablecoin-grow-a8140d952c7e8.jpg … By Cointelegraph 2025-07-25
Asia’s OSL Group raises $300M for stablecoin and global expansion !Asias OSL Group raises 300M for stablecoin and global expansionimagesnewsasias-osl-group-raises-300m-for-stablecoin-and-glofabca2060a8f.jpg OSL said … By Cointelegraph 2025-07-25
Bitcoin Demand Outstrips Supply Ahead of August Lull: Crypto Daybook Americas By James Van Straten All times ET unless indicated otherwise Bitcoin BTC has dropped 3 in the past 24 hours and is currently some 7 below its June 14 … By CoinDesk 2025-07-25
Maple Finance's SYRUP Bucks Bearish Crypto Slump With 23% Upside Move Decentralized finance DeFi protocol Maple Finance SYRUP has swept away any bearish crypto sentiment, rising by 23 in the past 24 hours after it was … By CoinDesk 2025-07-25
How Pump.fun raised $500M in 12 minutes, and what it says about retail FOMO !How Pump.fun raised 500M in 12 minutes, and what it says about retail … By Cointelegraph 2025-07-25
Arizona woman sentenced for helping North Korea coders get US crypto jobs !Arizona woman sentenced for helping North Korea coders get US crypto … By Cointelegraph 2025-07-25
APT Surges 5% From Lows Despite Market Volatility and $960M in Altcoin Liquidations Aptos APT exhibited exceptional price volatility throughout the 24-hour trading period, establishing a comprehensive trading range of 5.4, spanning … By CoinDesk 2025-07-25
Bitcoin grabs $115K liquidity as whale bets on $200K BTC price by year-end !Bitcoin grabs 115K liquidity as whale bets on 200K BTC price by year-endimagesnewsbitcoin-grabs-115k-liquidity-as-whale-bets-on-200k4f331391372c.jpg … By Cointelegraph 2025-07-25
Bitcoin to Hit $135K by Year-End in Base-Case Forecast, $199K in Bullish Scenario: Citi Wall Street bank Citi C refined its crypto valuation models to reflect the evolving dynamics of the digital asset market, producing a new year-end … By CoinDesk 2025-07-25
Satoshi-era $9.7B Bitcoin OG: Galaxy moves another $1.1B to exchanges !Satoshi-era 9.7B Bitcoin OG Galaxy moves another 1.1B to exchangesimagesnewssatoshi-era-9-7b-bitcoin-og-galaxy-moves-another-18c76ab2d12b5.jpg … By Cointelegraph 2025-07-25
Bitcoin 'strength' index crashes as Galaxy Digital sales liquidate $500M !Bitcoin strength index crashes as Galaxy Digital sales liquidate 500Mimagesnewsbitcoin-strength-index-crashes-as-galaxy-digital-sa99f6cab2a6a.jpg … By Cointelegraph 2025-07-25
NFT market cap surged to $6.6B in July: DappRadar !NFT market cap surged to 6.6B in July DappRadarimagesnewsnft-market-cap-surged-to-6-6b-in-july-dappradar767f126b401d.jpg NFT market cap hits 6.6 … By Cointelegraph 2025-07-25
Crypto Exchange OSL Group Raises $300M Ahead of Hong Kong's Stablecoin Regulation Plan Hong Kong-based cryptocurrency exchange OSL Group has raised 300 million in an equity … By CoinDesk 2025-07-25
XRP Drops 14% After $175M Moved to Exchange by Ripple Co-Founder's Wallet XRP slipped from last-weeks record high as a wallet attributed to Ripple co-founder Chris Larsen made a number of large transactions. Between July 17 … By CoinDesk 2025-07-25
Ether ETFs outpace Bitcoin for 6 straight days in rare flip !Ether ETFs outpace Bitcoin for 6 straight days in rare flipimagesnewsether-etfs-outpace-bitcoin-for-6-straight-days-in-56dab5f01fcf.jpg Spot Ether … By Cointelegraph 2025-07-25
Hulk Hogan, Ozzy memecoins soar as tributes roll in over icons’ deaths !Hulk Hogan, Ozzy memecoins soar as tributes roll in over icons deathsimagesnewshulk-hogan-ozzy-memecoins-soar-as-tributes-roll-inba32adabab27.jpg … By Cointelegraph 2025-07-25
Logan Paul can’t blame CryptoZoo co-founders for collapse, judge says !Logan Paul cant blame CryptoZoo co-founders for collapse, judge saysimagesnewslogan-paul-cant-blame-cryptozoo-co-founders-for-co5236db1793ee.jpg A … By Cointelegraph 2025-07-25
Crypto Market Retreats Amid Record Liquidity and Signs of Froth Despite record liquidity levels, traders are pulling back as leveraged positions unwind and profit-taking accelerates across major tokens. By Decrypt 2025-07-25
Lightning Network could nab 5% of stablecoin flows by 2028: Voltage CEO !Lightning Network could nab 5 of stablecoin flows by 2028 Voltage CEOimagesnewslightning-network-could-nab-5-of-stablecoin-flows-efcdc42cdd6e.jpg … By Cointelegraph 2025-07-25
XRP Volatility Spikes With $105M in Longs Liquidated Amid ETF Jitters What to Know XRP posted sharp losses during the July 2425 session, dropping 8 as the token traded in a 0.30 range from 2.96 to 3.26. An early session … By CoinDesk 2025-07-25
Bitcoin Slides to $115K as Dow Jones' Rally Stalls at December-January High Bitcoins BTC price dropped early Friday, marking a bearish resolution to the recent range play as the U.S. equity markets showed signs of an uptrend … By CoinDesk 2025-07-25
Ark Invest Dumps $12M Coinbase Shares After Loading Up on Ether Treasury Firm Bitmine Ark Invest, the investment firm led by Cathie Wood, offloaded 12 million worth of Coinbase COIN on Thursday, continuing the trend of taking profit … By CoinDesk 2025-07-25
Bitcoin tumbles below $116K in bloodbath for crypto longs !Bitcoin tumbles below 116K in bloodbath for crypto longsimagesnewsbitcoin-tumbles-below-116k-in-bloodbath-for-crypto27248121bc7a.jpg The sudden … By Cointelegraph 2025-07-25
Volmex's Bitcoin and Ether Volatility Futures Top $10M Volume Since Debut as Traders Look Beyond Price Futures tied to Volmexs bitcoin BTC and ether ETH implied volatility indices, BVIV and EVIV, have registered a cumulative trading volume of over 10 … By CoinDesk 2025-07-25
Arizona TikToker Sentenced for Aiding $17M North Korean IT Worker Scheme The Arizona woman helped North Korean operatives pose as U.S. IT workers and launder millions back to Pyongyang. By Decrypt 2025-07-25
Ether will ‘knock on $4,000’ and soon outperform Bitcoin: Novogratz !Ether will knock on 4,000 and soon outperform Bitcoin Novogratzimagesnewsether-will-knock-on-4000-and-soon-outperform-bitco2f23eea0d990.jpg Galaxy … By Cointelegraph 2025-07-25
Roman Storm Trial: Is Coding A Crime? The Tornado Cash Court Battle Intensifies NEW YORK The government officially rested its case against Tornado Cash developer Roman Storm on Thursday, bringing eight days of witness testimony … By CoinDesk 2025-07-25
Bitmine gobbles over $2B in ETH in 16 days amid treasury arms race !Bitmine gobbles over 2B in ETH in 16 days amid treasury arms raceimagesnewsbitmine-gobbles-over-2b-in-eth-in-16-days-amid-tre604c8415ed3d.jpg … By Cointelegraph 2025-07-25
Auction house Christie’s debuts crypto-only real estate team !Auction house Christies debuts crypto-only real estate teamimagesnewsauction-house-christies-debuts-crypto-only-real-es93962a5b2b34.jpg Christies, a … By Cointelegraph 2025-07-25
Bitcoin Whale Wagers $23.7M on BTC Rally to $200K by Year-End Bitcoins BTC price rally may have stalled lately, but bullish conviction certainly hasnt, as whales continue to bet millions on an extended market … By CoinDesk 2025-07-25
Nigeria Invites Stablecoin Startups, a Year After Binance Crackdown Nigeria is open to stablecoin firms, signaling a shift over a year after a Binance crackdown shook the local crypto industry. By Decrypt 2025-07-25
New ChatGPT Agent Can Book, Browse, and Fill Forms—Just Don't Trust It Yet OpenAIs new ChatGPT agent can automate web tasks like logging in and scheduling, but its launch comes with serious security warnings. By Decrypt 2025-07-25
Ether vulnerable as ‘meaningful unwinding’ on horizon — Analyst !Ether vulnerable as meaningful unwinding on horizon Analystimagesnewsether-vulnerable-as-meaningful-unwinding-on-horizo0da9f87c1690.jpg The surging … By Cointelegraph 2025-07-25
US crypto legislation drives $4B surge in stablecoin supply !US crypto legislation drives 4B surge in stablecoin supplyimagesnewsus-crypto-legislation-drives-4b-surge-in-stablecoi55422e21b459.jpg Regulatory … By Cointelegraph 2025-07-24
BlackRock’s Ethereum ETF Rockets to $10B, Third-Fastest in History BlackRocks iShares Ethereum Trust has reached 10 billion, faster than all but two funds in the ETF industrys 32-year history. By Decrypt 2025-07-24
Cognition’s AI Developer ‘Devin’ Eyes $10 Billion Valuation—Even If It’s Not Mindblowing Yet Cognition is seeking to achieve a jaw-dropping 10B valuation as investors race to back the next big thing. Can its autonomous coder be it? By Decrypt 2025-07-24
Bitcoin Could Hit $150K This Year, Says Mike Novogratz—But Ethereum Might Outperform BTC Investors were recently shorting ETH but now theyre enthusiastic about the digital coin, said Galaxy CEO Mike Novogratz. By Decrypt 2025-07-24
Ex-Gemini, Kraken exec appointed as CEO of crypto advocacy group !Ex-Gemini, Kraken exec appointed as CEO of crypto advocacy groupimagesnewsex-gemini-kraken-exec-appointed-as-ceo-of-crypto-afd2da1dfa37d.jpg Ji Hun … By Cointelegraph 2025-07-24
MEV arbitrageurs on Ethereum increasingly centralized — Research !MEV arbitrageurs on Ethereum increasingly centralized Researchimagesnewsmev-arbitrageurs-on-ethereum-increasingly-centrali529d812eec44.jpg … By Cointelegraph 2025-07-24
Why XRP Ledger Is a 'Different Network' Than Last Year: Analyst XRP is flying high, but activity on the Ripple-linked XRP Ledger points to a clear shift in user activity, according to analysis. By Decrypt 2025-07-24
Ethereum Treasury Firm Buys $5M CryptoPunk—And Is Borrowing Stablecoins Against It GameSquare, a digital media company with an Ethereum treasury strategy, is borrowing stablecoins against its newly acquired CryptoPunk NFT. By Decrypt 2025-07-24
Bitcoin is losing its bullish momentum: Is a drop to $115K next? !Bitcoin is losing its bullish momentum Is a drop to 115K next?imagesnewsbitcoin-is-losing-its-bullish-momentum-is-a-drop-t9b498bad4c89.jpg Bitcoin … By Cointelegraph 2025-07-24
Ripple's Chris Larsen Has Moved $140 Million in XRP to Exchanges During Record Surge The moves came as XRP reached an all-time high. It has more recently retreated. By Decrypt 2025-07-24
Elon Musk’s xAI Partners With Kalshi to Bring Grok to Prediction Markets Elon Musks artificial intelligence startup xAI is partnering with regulated prediction market Kalshi to bring its chatbot Grok into the world of … By CoinDesk 2025-07-24
Tom Lee's BitMine Now Largest Corporate Ethereum Treasury With $2.1 Billion in ETH The NYSE-traded firm said that it now held 566,776 ETH. By Decrypt 2025-07-24
XRP vs ETH: Which token is quietly outperforming in whale-fueled rallies? !XRP vs ETH Which token is quietly outperforming in whale-fueled rallies?imagesnewsxrp-vs-eth-which-token-is-quietly-outperforming-in0591b3c6e514.jpg … By Cointelegraph 2025-07-24
ETH core developer testifies in Roman Storm defense as gov’t rests case !ETH core developer testifies in Roman Storm defense as govt rests caseimagesnewseth-core-developer-testifies-in-roman-storm-defens941afc712cd5.jpg … By Cointelegraph 2025-07-24
Myriad Moves: Will SharpLink Buy More Ethereum? And PUMP vs Fartcoin, Who Wins? Myriad Markets users are making predictions on SharpLink Gamings Ethereum holdings, PENGUs price, and a matchup between PUMP and Fartcoin. By Decrypt 2025-07-24
‘Every family here is sick,‘ say neighbors of Bitcoin mining facility in Texas !Every family here is sick, say neighbors of Bitcoin mining facility in … By Cointelegraph 2025-07-24
DOGE news update: Treasury purchases may kickstart rally to $0.29 !DOGE news update Treasury purchases may kickstart rally to 0.29imagesnewsdoge-news-update-treasury-purchases-may-kickstart-3020bea51832.jpg Bit … By Cointelegraph 2025-07-24
After Nearly Dying, Former UFC Star Ben Askren Promotes Crypto Scam Celebrity meme coin creator Sahil Arora claims to be behind Askrens promo of a Solana meme coin that rugged investors. By Decrypt 2025-07-24
Senate Will End Up Passing House Version of Crypto Market Structure, Says Tom Emmer The Senate is working on its own version of the crypto market structure bill, after already getting stablecoin legislation passed into law. By Decrypt 2025-07-24
Fintech, crypto groups press Trump to protect open banking amid bank pushback !Fintech, crypto groups press Trump to protect open banking amid bank … By Cointelegraph 2025-07-24
Polkadot's DOT Bounces After 7% Decline Polkadots DOT staged a strong recovery after slumping as much as 7, bouncing from 3.91 to 4.08 amid high trading volumes, according to CoinDesk … By CoinDesk 2025-07-24
How to use ChatGPT Agent for crypto trading in 2025 !How to use ChatGPT Agent for crypto trading in 2025imagesnewshow-to-use-chatgpt-agent-for-crypto-trading-in-202f58b871aa745.jpg ChatGPT Agents can … By Cointelegraph 2025-07-24
Will Hyperliquid Hit $69.69 Before September? The Odds Don’t Favor Bulls HYPE needs to pump by more than 60 to hit the meme number before September. Can it still happen? By Decrypt 2025-07-24
Ether to show Bitcoin 'leadership' as BTC ETFs lose $285M: Research !Ether to show Bitcoin leadership as BTC ETFs lose 285M Researchimagesnewsether-to-show-bitcoin-leadership-as-btc-etfs-lose-99431f9c1864.jpg Ether … By Cointelegraph 2025-07-24
Ethena to Bring $1.5 Billion USDtb Stablecoin to US with Anchorage Digital Ethena Labs UDStb will debut in the U.S., less than a week after the countrys lawmakers passed a landmark stablecoin law. By Decrypt 2025-07-24
Bitcoin consolidation expected to end with impulse move to $135K: Data !Bitcoin consolidation expected to end with impulse move to 135K Dataimagesnewsbitcoin-consolidation-expected-to-end-with-impulse0e5b0299d24f.jpg … By Cointelegraph 2025-07-24
Yuga Labs Bored Ape Yacht Club $9M Win Against Ryder Ripps Overturned, Must Better Prove Trademark Infringement The creator of the Bored Ape Yacht Club non-fungible tokens NFTs needs to better prove that a satirical version of these tokens was meant to mislead … By CoinDesk 2025-07-24
Strategy expands preferred stock offering to $2B amid Bitcoin-fueled rally — Report !Strategy expands preferred stock offering to 2B amid Bitcoin-fueled rally … By Cointelegraph 2025-07-24
Trading platform WOO X pauses withdrawals after $14M breach !Trading platform WOO X pauses withdrawals after 14M breachimagesnewstrading-platform-woo-x-pauses-withdrawals-after-143623fe454b96.jpg The hack only … By Cointelegraph 2025-07-24
Satoshi-Era Bitcoin Whale Moves $469 Million in BTC After 14 Years A Bitcoin whale holding nearly half a billion dollars in BTC moved the fortune to a new address Thursday after more than 14 years. By Decrypt 2025-07-24
The Future of Prediction Markets Is Content-Native Myriad is transforming passive readers into active participants by embedding on-chain prediction markets directly into media content. By Decrypt 2025-07-24
Anchorage Digital announces stablecoin issuance platform on GENIUS' heels !Anchorage Digital announces stablecoin issuance platform on GENIUS heelsimagesnewsanchorage-digital-announces-stablecoin-issuance-pl20ed9ac7d0ec.jpg … By Cointelegraph 2025-07-24
ICP Falls Sharply From $5.76 High Amid Renewed Bearish Pressure Internet Computer ICP experienced a sharp reversal after climbing to 5.76, with the token falling to 5.59httpswww.coindesk.compriceinternet-computer … By CoinDesk 2025-07-24
Why 'Expensive' Ethereum Will Dominate Institutional DeFi With over 100httpsl2beat.comscalingsummary layer-2 L2 blockchains, youre excused for thinking Ethereum is too expensive and too slow. But ask any … By CoinDesk 2025-07-24
Michael Saylor's Strategy Boosts Latest Preferred Share Raise to $2B From $500M: Bloomberg Strategy MSTR, the worlds largest corporate bitcoin BTC holder helmed by Michael Saylor, has lifted the size its preferred stock offering STRC to 2 … By CoinDesk 2025-07-24
Vine Meme Coin Spikes After Elon Musk Says the App Is Returning—With an AI Twist Once-popular video app Vine is returning with an AI twist, Elon Musk said Thursdayand crypto bros are now pumping the Vine meme coin. By Decrypt 2025-07-24
NEAR Protocol Rebounds 9% as Investors Capitalize on Market Dislocation NEAR experienced notable price volatility over the 24-hour period ending July 24 at 1500, with its token trading between 2.59 and 2.83. The sharp … By CoinDesk 2025-07-24
BONK Jumps 6.5% as Solana-Based Meme Token Captures Market Share BONK posted a strong recovery on July 24, gaining 6.5 in value from 0.0000335 to 0.0000357httpswww.coindesk.compricebonk during the 24-hour window … By CoinDesk 2025-07-24
ATOM Surges 7% After Sharp Plunge to $4.47 Support Level After a heavy bout of selling pressure during the early hours of July 24, ATOM demonstrated impressive resilience, rebounding from an intraday low of … By CoinDesk 2025-07-24
Ether Surges 4% as ETH Treasury Firm BitMine Steps Up Bid to Acquire 5% of Supply Ether extended its rally Thursday after BitMine Immersion Technologies BMNR announced that its holdings of the second most valuable cryptocurrency … By CoinDesk 2025-07-24
ALTS HEAD LOWER, GOLDMAN SACHS TO TOKENISE FUNDS, TRUMP VISITS FED BTC dominance rises, XRP leads major altcoins lower. ETH ETFs see daily inflows for 2 weeks in a row. GS, BNY Mellon to launch tokenised funds. US … By Decrypt 2025-07-24
ADA dip buyers defend key support: Will the bounce lead to $1? !ADA dip buyers defend key support Will the bounce lead to 1?imagesnewsada-dip-buyers-defend-key-support-will-the-bounce-b63b942d0900.jpg Buyers … By Cointelegraph 2025-07-24
Retail XRP Holders Could Soon Earn 20% Yield on Their Tokens DeFi protocol MoreMarkets has launched a new XRP Earn Account, giving retail investors access to yield strategies long reserved for institutions and … By CoinDesk 2025-07-24
Ether Treasury Company GameSquare Buys CryptoPunk NFT for $5.15M Digital media company GameSquare GAME said it bought Cowboy Ape 5577 of the CryptoPunk non-fungible token NFT … By CoinDesk 2025-07-24
Bitcoin miners pivot to HPC: Bitzero raises $25M to expand into high-margin data centers !Bitcoin miners pivot to HPC Bitzero raises 25M to expand into high-margin data … By Cointelegraph 2025-07-24
Ripple CEO Warns of YouTube XRP Scams Following All-Time High Surge With XRP up over 48 in the past month, increased retail interest has been accompanied by a wave of impersonation scams. By Decrypt 2025-07-24
How Solana Is Evolving to Power Internet Capital Markets Key Solana builders have united around a roadmap in an attempt to cement the network as the home for internet capital markets. By Decrypt 2025-07-24
Why Is Bitcoin Holding Steady as XRP, Solana, Dogecoin Waver? BTC stays resilient above 119,000, while major altcoins continued to linger in negative territory, as volatility hits new lows and institutions keep … By Decrypt 2025-07-24
Ethereum analysts see ‘further upside’ as ETH price reclaims $3.6K !Ethereum analysts see further upside as ETH price reclaims 3.6Kimagesnewsethereum-analysts-see-further-upside-as-eth-price-e16fbcc15851.jpg Ethereum … By Cointelegraph 2025-07-24
Ethena Taps Anchorage to Issue $1.5B USDtb Stablecoin Under GENIUS Act Decentralized finance DeFi platform Ethena is set to bring its 1.5 billion stablecoin to the U.S. market, teaming up with crypto bank Anchorage … By CoinDesk 2025-07-24
Two Men Charged in NYC Crypto Torture Case Released on $1 Million Bail Each The pair must wear ankle monitors and surrender passports as part of their bail terms, while awaiting trial on crypto-related torture charges. By Decrypt 2025-07-24
SUI Rebounds After Overnight Sell-Off Amid ETF Momentum SUI SUIhttpswww.coindesk.compricesui rebounded forcefully on Thursday, rising to 3.78 from 3.52 in just five hours, after slumping 8 during the U.S. … By CoinDesk 2025-07-24
Crypto for Advisors: Blockchain and the Music Industry Blockchain is reshaping industries beyond finance. In this Crypto for Advisors newsletter, we shift focus from traditional investments to explore a … By CoinDesk 2025-07-24
Solana Players Unveils ‘Internet Capital Markets’ Roadmap Solanas ecosystem is coalescing around an updated vision its architects call Internet Capital Marketsa decentralized, high-performance foundation for … By CoinDesk 2025-07-24
Solana unveils 2027 roadmap to lead internet capital markets !Solana unveils 2027 roadmap to lead internet capital marketsimagesnewssolana-unveils-2027-roadmap-to-lead-internet-capitd53f57f9007f.jpg The Solana … By Cointelegraph 2025-07-24
Tokenomics are broken, and only contribution can fix this !Tokenomics are broken, and only contribution can fix thisimagesnewstokenomics-are-broken-and-only-contribution-can-fi5404497355f6.jpg Traditional … By Cointelegraph 2025-07-24
How hackers stole $44M from CoinDCX without touching user wallets !How hackers stole 44M from CoinDCX without touching user walletsimagesnewshow-hackers-stole-44m-from-coindcx-without-touchina80c94b4a6f9.jpg A … By Cointelegraph 2025-07-24
BlackRock Ethereum ETF becomes 3rd-fastest to hit $10B in assets !BlackRock Ethereum ETF becomes 3rd-fastest to hit 10B in assetsimagesnewsblackrock-ethereum-etf-becomes-3rd-fastest-to-hit-9cd286597928.jpg … By Cointelegraph 2025-07-24
Stablecoin Supply to Grow as Much as $75B Following Passage of GENIUS Act, BofA Says Bank of America BAC says the GENIUS … By CoinDesk 2025-07-24
UK crypto hopes stall, but ‘encouraging signs’ are there !UK crypto hopes stall, but encouraging signs are thereimagesnewsuk-crypto-hopes-stall-but-encouraging-signs-are-thdc4bb5428d83.jpg The crypto … By Cointelegraph 2025-07-24
Franklin Templeton to bring BENJI platform to VeChain for enterprise payments !Franklin Templeton to bring BENJI platform to VeChain for enterprise … By Cointelegraph 2025-07-24
How traditional financial tools are making crypto investing more accessible !How traditional financial tools are making crypto investing more … By Cointelegraph 2025-07-24
Bitcoin treasury fever grows in Japan as AI company targets 3,000 BTC !Bitcoin treasury fever grows in Japan as AI company targets 3,000 BTCimagesnewsbitcoin-treasury-fever-grows-in-japan-as-ai-compan4b8fcd564662.jpg … By Cointelegraph 2025-07-24
CoinDesk 20 Performance Update: Aptos (APT) Declines 5.3% as Index Trades Lower CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-07-24
Build on Bitcoin adds ZK-proofs in upgrade toward decentralization !Build on Bitcoin adds ZK-proofs in upgrade toward decentralizationimagesnewsbuild-on-bitcoin-adds-zk-proofs-in-upgrade-toward-e444859f38cc.jpg Build … By Cointelegraph 2025-07-24
India Ramps Up Crypto Tax Enforcement with International Data Sharing and AI While India is making use of data analytics, it still lacks real-time surveillance of crypto tax disclosures. By Decrypt 2025-07-24
UK company smashes local Bitcoin treasury record with $135M raise !UK company smashes local Bitcoin treasury record with 135M raiseimagesnewsuk-company-smashes-local-bitcoin-treasury-record-w4900044e9e98.jpg Satsuma … By Cointelegraph 2025-07-24
Societe Generale to make markets in 21Shares Bitcoin, Ether ETPs !Societe Generale to make markets in 21Shares Bitcoin, Ether ETPsimagesnewssociete-generale-to-make-markets-in-21shares-bitcoe6af5f0e9cf8.jpg Societe … By Cointelegraph 2025-07-24
FTX to begin $1.9B payouts in September as claims no longer disputed !FTX to begin 1.9B payouts in September as claims no longer disputedimagesnewsftx-to-begin-1-9b-payouts-in-september-as-claims-n7bbe4832a850.jpg FTXs … By Cointelegraph 2025-07-24
Crypto Inflows Surge to $60B Year-to-Date, Outpacing Private Equity: JPMorgan Capital is flooding into digital assets at a record pace this year, according to Wall Street bank JPMorgan JPM, marking a sharp contrast with … By CoinDesk 2025-07-24
Multisig Failures Dominate as $3.1B Is Lost in Web3 Hacks in the First Half Crypto investors lost around 3.1 billion to hacks in the first half of the year, with the first quarter alone topping all the losses of 2024, … By CoinDesk 2025-07-24
Men accused in New York crypto torture case out on bail !Men accused in New York crypto torture case out on bailimagesnewsmen-accused-in-new-york-crypto-torture-case-out-ondb7a1bb7bce1.jpg The suspects … By Cointelegraph 2025-07-24
BNB Falls 4.3% as Traders Eye Key Support Levels After Record High BNB slid 4.3 in the last 24 hours, falling from 808 to 764 in a sharp pullback that erased a portion of its gains month-to-date. The drop came on … By CoinDesk 2025-07-24
DOGE, PEPE, PUMP Bleed As Pump.fun Confirms No Airdrop 'In Immediate Future' Meme coins are down bad after token launchpad Pump.fun said that it wont be issuing an airdrop in the immediate future. By Decrypt 2025-07-24
XRP Rebounds From Nearly $3 After 10% Drop, Signals Possible Bottom What to Know XRP fell 10.14 in the 24-hour session from July 23 at 1200 to July 24 at 1100, declining from 3.45 to 3.10. The selloff accelerated … By CoinDesk 2025-07-24
XRP Price Crashes 10%; Focus on Bitcoin-Yen's 'Descending Triangle' as Fed Rate Cut Bets Rise This is a daily analysis of top tokens with CME futures by CoinDesk analyst and Chartered Market Technician Omkar Godbole. BTCJPY Focus on descending … By CoinDesk 2025-07-24
Solana Eyes 66% Block Size Bump With New Developer Proposal as Network Demand Grows Solana developers are considering increasing the networks block capacity by 66 as demand for block space on the most widely used network grows. A new … By CoinDesk 2025-07-24
Elon Musk floats robots in ‘cute outfits’ while Tesla earnings miss !Elon Musk floats robots in cute outfits while Tesla earnings missimagesnewselon-musk-floats-robots-in-cute-outfits-while-teslfcbc33a0b355.jpg Teslas … By Cointelegraph 2025-07-24
Altcoin Season Hope Dim as Traders Unwind Bullish Bets: Crypto Daybook Americas By Omkar Godbole All times ET unless indicated otherwise Bitcoins BTC consolidation continues to take the wind out of the bull run in the broader … By CoinDesk 2025-07-24
Crypto hacks surpass $3.1B in 2025 as access flaws persist: Hacken !Crypto hacks surpass 3.1B in 2025 as access flaws persist Hackenimagesnewscrypto-hacks-surpass-3-1b-in-2025-as-access-flaws-4760f3226edb.jpg Over … By Cointelegraph 2025-07-24
XRP price drops 19% but analysts say it’s a ‘healthy correction’ !XRP price drops 19 but analysts say its a healthy correctionimagesnewsxrp-price-drops-19-but-analysts-say-its-a-healthy-cc9ee6097de4.jpg XRP price … By Cointelegraph 2025-07-24
Hong Kong to criminalize unlicensed stablecoin promotions from Aug. 1 !Hong Kong to criminalize unlicensed stablecoin promotions from Aug. 1imagesnewshong-kong-to-criminalize-unlicensed-stablecoin-pro21a83872b903.jpg … By Cointelegraph 2025-07-24
Ghana Plans Crypto Firm Licensing in Response to Growing Demand: Bloomberg Ghana is set to begin licensing cryptocurrency platforms in response to a surge in demand for digital assets in the West African country, Bloomberg … By CoinDesk 2025-07-24
XRP dump: Ripple co-founder under fire for moving $175M XRP near highs !XRP dump Ripple co-founder under fire for moving 175M XRP near highsimagesnewsxrp-dump-ripple-co-founder-under-fire-for-moving-1ddfc04c7438d.jpg … By Cointelegraph 2025-07-24
Australian fintech Finder wins court battle over crypto yield product !Australian fintech Finder wins court battle over crypto yield productimagesnewsaustralian-fintech-finder-wins-court-battle-over-ce6e7e67d475a.jpg … By Cointelegraph 2025-07-24
Crypto Industry Asks President Trump to Stop JPMorgan’s 'Punitive Tax' on Data Access Ten of the largest trade associations in fintech and crypto have called on President Donald Trump to intervene in what they say is a coordinated … By CoinDesk 2025-07-24
Bitcoin due 'massive short squeeze' as BTC dominance bounces to 62% !Bitcoin due massive short squeeze as BTC dominance bounces to 62imagesnewsbitcoin-due-massive-short-squeeze-as-btc-dominancec7deff1fe081.jpg Bitcoin … By Cointelegraph 2025-07-24
BTC, XRP, SOL, ETH Witness 'Long Squeeze' as Futures Open Interest Slides With Prices Thursdays price pullback in major cryptocurrencies is probably the result of a long squeeze, or unwinding of leveraged bullish plays, rather than an … By CoinDesk 2025-07-24
Amended class action calls Pump.fun a ‘slot machine cabinet’ in $5.5B case !Amended class action calls Pump.fun a slot machine cabinet in 5.5B caseimagesnewsamended-class-action-calls-pump-fun-a-slot-machine4dbeb2db61fc.jpg … By Cointelegraph 2025-07-24
Golden visas are shrinking for crypto investors !Golden visas are shrinking for crypto investorsimagesnewsgolden-visas-are-shrinking-for-crypto-investorsa4a5a5e96a58.jpg Wealthy crypto investors … By Cointelegraph 2025-07-24
US Ether ETFs celebrate 1 year with bullish inflow streak !US Ether ETFs celebrate 1 year with bullish inflow streakimagesnewsus-ether-etfs-celebrate-1-year-with-bullish-inflow4d6342996a62.jpg Spot Ether … By Cointelegraph 2025-07-24
Trump’s Crypto Working Group Set to Deliver Report—What Experts Expect To See The report could recommend ways for the government to build a Bitcoin stockpile without using taxpayer funds, Decrypt was told. By Decrypt 2025-07-24
Dogecoin Plunges 11% as Institutional Bets Seen Exiting Amid Heavy Selloff Dogecoin posted a sharp decline during the July 2324 trading session, shedding 11 from 0.26 to 0.24 amid sustained institutional sell pressure and … By CoinDesk 2025-07-24
Crypto Rally Stalls—Correction Ahead For XRP, Solana and Top Altcoins or Just Market Noise? The altcoin rally is cooling as Bitcoin trades sideways, with analysts citing short-term fatigue despite a supportive macro backdrop. By Decrypt 2025-07-24
'Wall Streetization' of Bitcoin: BTC Volatility Index and the S&P 500 VIX Boast Record 90-Day Correlation New statistical evidence has emerged, suggesting that bitcoins BTC market dynamics are now intricately linked to the ebb and flow on Wall Street. … By CoinDesk 2025-07-24
Bros who tricked MEV bots with their own medicine must face trial, says judge !Bros who tricked MEV bots with their own medicine must face trial, says … By Cointelegraph 2025-07-24
Solana block capacity is up 20% and there’s a proposal for it to go even higher !Solana block capacity is up 20 and theres a proposal for it to go even … By Cointelegraph 2025-07-24
Solana, Pump.fun Named in Amended RICO Suit Alleging $5.5B Meme Coin Gambling Scheme The class action alleges Pump.fun operated an unlicensed gambling platform, estimating billions in user losses with Solana-linked entities. By Decrypt 2025-07-24
FTX to Start Next Round of Creditor Repayments on Sept. 30 FTX, the once prominent crypto exchange, will begin the next round of cash redistribution on Sept. 30, the bankrupt firm said in a statement on … By CoinDesk 2025-07-24
XRP Ledger Tapped for Tokenizing $130M Agribusiness Credit as Brazil's RWA Push Accelerates Brazilian securitization firm VERT has launched a blockchain-based private credit platform on the XRP Ledger, debuting with a brazilian real 700 … By CoinDesk 2025-07-24
Ether, XRP Traders Book Bigger Losses Than Bitcoin as Crypto Bulls See $630M in Liquidations A sharp pullback across crypto markets on Tuesday triggered nearly 735 million in liquidations with bulls bearing the brunt. Ether ETH and XRP XRP … By CoinDesk 2025-07-24
Ether stumbles as ETH validator exit queue hits 18-month high !Ether stumbles as ETH validator exit queue hits 18-month highimagesnewsether-stumbles-as-eth-validator-exit-queue-hits-18f9c90ce498ae.jpg The … By Cointelegraph 2025-07-24
Trump Bans ‘Woke AI’ From Federal Contracts in New Executive Order The order requires ideological neutrality and bans DEI-aligned large language models from government contracts. By Decrypt 2025-07-24
US appeals court overturns Yuga Labs’ $9M win against Ryder Ripps !US appeals court overturns Yuga Labs 9M win against Ryder Rippsimagesnewsus-appeals-court-overturns-yuga-labs-9m-win-againscb231e641cfe.jpg The US … By Cointelegraph 2025-07-24
XRP tanks 10% but ATH comeback is still in play: Bitpanda exec !XRP tanks 10 but ATH comeback is still in play Bitpanda execimagesnewsxrp-tanks-10-but-ath-comeback-is-still-in-play-bit13f2d2dbf597.jpg A crypto … By Cointelegraph 2025-07-24
Scammers pounce as crypto markets touch new all-time highs !Scammers pounce as crypto markets touch new all-time highsimagesnewsscammers-pounce-as-crypto-markets-touch-new-all-ti4dccaace1aa5.jpg Ripple warns … By Cointelegraph 2025-07-24
Is PayPal’s New Fiat Platform a Stablecoin Killer? PayPal World will link major domestic digital wallets, but legacy constraints could limit its challenge to stablecoins, Decrypt was told. By Decrypt 2025-07-24
Asia Morning Briefing: Animoca Exec Says U.S. Heat Is Pushing China's Stablecoin Agenda Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-07-24
Another ICO Boom? What the Senate’s Market Structure Bill Means for Crypto Startups Days after a crypto market structure bill passed the House with bipartisan support, the Senate introduced its own version of the legislation. Heres … By Decrypt 2025-07-23
Crypto 'control' takes center stage at Roman Storm trial !Crypto control takes center stage at Roman Storm trialimagesnewscrypto-control-takes-center-stage-at-roman-storm-t2c575064de7a.jpg With the trial of … By Cointelegraph 2025-07-23
Ethereum to Hit $10K and ‘Tear the Market a New Asshole’, Says Arthur Hayes BitMEX founder Arthur Hayes now thinks that Ethereum will soar to 10,000 this year, doubling his previous projection. Heres why. By Decrypt 2025-07-23
Ether emerges as winner after crypto’s ‘watershed moment’: Bitwise !Ether emerges as winner after cryptos watershed moment Bitwiseimagesnewsether-emerges-as-winner-after-cryptos-watershed-mob912456fc640.jpg A … By Cointelegraph 2025-07-23
Asymmetric shifts funds strategy after investor posts losses on X !Asymmetric shifts funds strategy after investor posts losses on Ximagesnewsasymmetric-shifts-funds-strategy-after-investor-po35e2365a4812.jpg After … By Cointelegraph 2025-07-23
Square Begins Bitcoin Payments for Sellers as Block Stock Hits S&P 500 Blocks share price has risen more than 14 over the past week. By Decrypt 2025-07-23
White House Releases Trump's 'AI Action Plan'—Here's What's in It President Trumps American AI Action Plan is here, and its drawing praiseand criticismfor prioritizing growth over safety. By Decrypt 2025-07-23
SOL price drop to $180 would be 'golden' entry before rally to new highs !SOL price drop to 180 would be golden entry before rally to new highsimagesnewssol-price-drop-to-180-would-be-golden-entry-before3732f141c211.jpg … By Cointelegraph 2025-07-23
Traditional companies enter the crypto treasury game with BTC, XRP and SOL buys !Traditional companies enter the crypto treasury game with BTC, XRP and SOL … By Cointelegraph 2025-07-23
Bitcoin and XRP Pull Back, But Bulls Have Reason for Optimism: Analysis Is it so over already just as crypto bulls were so back? Heres what the charts have to say. By Decrypt 2025-07-23
Tesla’s Bitcoin Holdings Now Worth $1.2B After 30% BTC Price Rally in Q2 Teslas TSLA bitcoin BTC stash is now worth around 1.2 billion after the cryptocurrencys price climbed 30 in the second quarter of this year, … By CoinDesk 2025-07-23
Some Tokenization Is Just ‘Gambling’, Says Prometheum Co-CEO The firms business model revolves around blockchain securities. By Decrypt 2025-07-23
Joe McCann Closes Asymmetric Liquid Fund After 'Shifting Away From Liquid Trading' Joe McCann is winding down Asymmetrics Liquid Alpha Fund after the fund was accused of losing massive value this year and drew sharp criticism … By CoinDesk 2025-07-23
Now Litecoin? Pharmaceuticals Firm Closes Deal to Fund $100M LTC Treasury Litecoin Foundation founder Charlie Lee will be joining MEI Pharmas board of directors. By Decrypt 2025-07-23
Fate of crypto, CBDC bills unclear as US Congress heads into recess !Fate of crypto, CBDC bills unclear as US Congress heads into recessimagesnewsfate-of-crypto-cbdc-bills-unclear-as-us-congress-h22002aa7115e.jpg … By Cointelegraph 2025-07-23
Block joins S&P 500, bringing more Bitcoin exposure to equity index !Block joins SP 500, bringing more Bitcoin exposure to equity indeximagesnewsblock-joins-s-p-500-bringing-more-bitcoin-exposured45669ffc34b.jpg … By Cointelegraph 2025-07-23
Are Things Getting Too Frothy for Ethereum, XRP and Other Top Altcoins? Is altcoin season in trouble? Ethereum, XRP, and Dogecoin are leading crypto losses Wednesday after alt open interest hit a new peak. By Decrypt 2025-07-23
XRP threatens drop to $3: Will bulls step in to buy the dip? !XRP threatens drop to 3 Will bulls step in to buy the dip?imagesnewsxrp-threatens-drop-to-3-will-bulls-step-in-to-buy-dbb053165dee.jpg XRPs tight … By Cointelegraph 2025-07-23
The Protocol: Ethereum Validator Exit Queue Backs Up Welcome to The Protocol, CoinDesks weekly wrap-up of the most important stories in cryptocurrency tech development. Im Margaux Nijkerk, CoinDesks … By CoinDesk 2025-07-23
Trump's AI plan eases data center rules, strips federal DEI guidelines !Trumps AI plan eases data center rules, strips federal DEI guidelinesimagesnewstrump-s-ai-plan-eases-data-center-rules-strips-fedb9f6119221b2.jpg … By Cointelegraph 2025-07-23
MoonPay launches Solana staking as investor demand for onchain yield grows !MoonPay launches Solana staking as investor demand for onchain yield … By Cointelegraph 2025-07-23
The Node: Tim Draper on Bitcoin’s Gravitational Pull Central to Drapers worldview is the notion that bitcoin is simply better technology than any government-issued currency. Roughly 20 of the global … By CoinDesk 2025-07-23
ETH news update: Can SharpLink Gaming, BitMine treasuries send Ether to $4K? !ETH news update Can SharpLink Gaming, BitMine treasuries send Ether to … By Cointelegraph 2025-07-23
'Tokyo Beast' Speedruns Crypto Game Cycle, Shutting Down Just a Month After Launch In a positive wrinkle, the makers of Tokyo Beast will compensate NFT owners and some TGT token holders amid the games closure. By Decrypt 2025-07-23
PEPE Plunges 5% on Volume Spike, but Whale Wallets Are Accumulating PEPE fell more than 5 in the last 24-hour period, dropping from a session high near 0.000014167 to a low of 0.000012915, before seeing a slight … By CoinDesk 2025-07-23
Grand Jury Charges Pastor, Wife in Alleged Multi-Million Dollar Cryptocurrency Scam A Denver grand jury has indicted a married couple on 40 counts of theft, fraud and deceit, for allegedly operating a multi-million-dollar … By CoinDesk 2025-07-23
MARA Stock Dives as Bitcoin Miner Reveals Plan to Raise $850 Million to Buy More BTC Bitcoin miner MARA Holdings plans to raise 850 million through a private sale to buy more BTCand its stock has fallen 10 on the day. By Decrypt 2025-07-23
SOL news update: Solana treasury building activates rally toward $240 !SOL news update Solana treasury building activates rally toward 240imagesnewssol-news-update-solana-treasury-building-activates1d79166a95a8.jpg SOL … By Cointelegraph 2025-07-23
Why Ethereum Will Keep Climbing in Coming Months: Bitwise Demand for Ethereum is likely to outpace supply, fueling continued gains. ETHs price has risen almost 14 over the past week despite dropping on … By Decrypt 2025-07-23
WisdomTree’s USDW stablecoin to pay dividends on tokenized assets !WisdomTrees USDW stablecoin to pay dividends on tokenized assetsimagesnewswisdomtrees-usdw-stablecoin-to-pay-dividends-on-to8709747e0114.jpg USDW is … By Cointelegraph 2025-07-23
NEAR Protocol Slides 5% as Altcoin Season Abruptly Ends NEAR Protocol endured a turbulent 24-hour stretch between July 22 1500 and July 23 1400, declining from 2.97 to 2.81 in a 5.41 move that underscored … By CoinDesk 2025-07-23
ICP Drops 5% as Crypto Market Rotates, Resistance Holds Internet Computer ICP recorded a 5.35 pullback over the last 24 hours, dropping from 6.01 to 5.69httpswww.coindesk.compriceinternet-computer as … By CoinDesk 2025-07-23
ATOM Sinks 5% Amid Altcoin Weakness, Faces Key Support Test Cosmos Hubs ATOM token suffered a steep decline over the past 24 hours, falling from 5.08 to 4.82 as institutional participants intensified … By CoinDesk 2025-07-23
PENGU & REKT ALL TIME HIGHS, HUGE ETH ETF INFLOWS, BNB OUTPERFORMS MARKET Crypto majors slightly red with BNB outperforming and hitting new ATH. ETH ETFs see 3rd biggest day of inflows while BTC sees net outflows. Coinbase … By Decrypt 2025-07-23
The Future of Digital Asset Infrastructure in Latin America An overlooked monetary shifthttpswww.cointeeth.comnewschainalysis-economic-turmoil-in-latin-america-boosts-the-rise-of has started in Latin America … By CoinDesk 2025-07-23
Goldman Sachs, BNY Mellon Collaborate on Tokenized Money Market Product Global financial firms Goldman Sachs and BNY Mellon are working together on a tokenized money market product. By Decrypt 2025-07-23
BONK Tests Support Levels After High-Volume Drop BONK has endured heavy selling pressure during the last 24 hours, with the Solana-based meme token falling 4 from 0.000035 to … By CoinDesk 2025-07-23
The Rate Renaissance: How Benchmark Rates Unlock DeFi’s Potential Benchmark rates have long been a cornerstone of traditional finance TradFi, underpinning trillions in financial instruments. Benchmarks like LIBOR … By CoinDesk 2025-07-23
Stablecoin Owners Outnumber Solana Holders: Reown Survey The growth of crypto payments points to the emerging use of crypto for utility rather than speculation, according to a new survey. By Decrypt 2025-07-23
BNB Briefly Tops $800 as Investors Adopt Risk-On Attitude, Corporate Adoption Grows BNB rose more than 3 in the past 24 hours, briefly topping 800 to reach a new high near 810. BNB peaked at 809.84 as trading volume exceeded the … By CoinDesk 2025-07-23
Square Begins Rollout of Bitcoin Payments for Sellers, Targets Full Availability by 2026 Jack Dorseys Square XYZ has begun the rollout of bitcoin payments for merchants on its network. Square began onboarding the first sellers, enabling … By CoinDesk 2025-07-23
Shiba Inu Tanks 7% With Broader Market, But Outperforms DOGE Shiba Inu SHIB has suffered significant losses in the past 24 hours, consistent with the broader markets decline. The joke token, however, narrowly … By CoinDesk 2025-07-23
Crypto ATMs were just banned in New Zealand: Here’s why it matters !Crypto ATMs were just banned in New Zealand Heres why it matters imagesnewscrypto-atms-were-just-banned-in-new-zealand-heres-e99c8619f7c1.jpg New … By Cointelegraph 2025-07-23
Goldman Sachs and BNY Mellon Team Up for Tokenized Money Market Funds Bank of New York Mellon BNY and Goldman Sachs GS are rolling out tokenized money market funds for clients as digital asset adoption is accelerating. … By CoinDesk 2025-07-23
Altcoin Season Takes Breather With SOL, XRP, TON Among Those Posting Heavy Losses Several of the largest altcoins suffered corrective moves to the downside on Wednesday, suggesting a pause or even end to altcoin season before it … By CoinDesk 2025-07-23
Bitcoin grabs bid liquidity as BTC price dip targets include $113K !Bitcoin grabs bid liquidity as BTC price dip targets include 113Kimagesnewsbitcoin-grabs-bid-liquidity-as-btc-price-dip-targe78bb63692ed1.jpg … By Cointelegraph 2025-07-23
DOGE price gained 340% the last time this indicator turned bullish !DOGE price gained 340 the last time this indicator turned bullishimagesnewsdoge-price-gained-340-the-last-time-this-indicatorb7f0c8ee0be7.jpg … By Cointelegraph 2025-07-23
Mara to raise up to $1B for Bitcoin and operations via debt sale !Mara to raise up to 1B for Bitcoin and operations via debt saleimagesnewsmara-to-raise-up-to-1b-for-bitcoin-and-operations-5ff3b1d92e17.jpg Mara … By Cointelegraph 2025-07-23
Denver Pastor, Wife Indicted in Alleged $3.4 Million Crypto Scam The couple allegedly spent the funds on cosmetic dentistry, luxury handbags, snowmobiles, and luxury vacations, according to investigators. By Decrypt 2025-07-23
CoinDesk 20 Performance Update: Ripple (XRP) Drops 5.2%, Leading Index Lower CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-07-23
Crypto entrepreneurs were fleeing America, but we can bring them back !Crypto entrepreneurs were fleeing America, but we can bring them backimagesnewscrypto-entrepreneurs-were-fleeing-america-but-we-c8813cfa5c746.jpg … By Cointelegraph 2025-07-23
Brazil's VERT Debuts Tokenized Credit Platform on XRP Ledger With $130M Issuance VERT, a Brazilian securitization and fund manager, said on Wednesday it debuted a blockchain-based platform to handle private credit transactions on … By CoinDesk 2025-07-23
Goldman Sachs, BNY to offer tokenized money market funds for clients !Goldman Sachs, BNY to offer tokenized money market funds for clientsimagesnewsgoldman-sachs-bny-to-offer-tokenized-money-market-32106f9a627c.jpg … By Cointelegraph 2025-07-23
How high can XRP price go from its $3.66 multimonth high? !How high can XRP price go from its 3.66 multimonth high?imagesnewshow-high-can-xrp-price-go-from-its-3-66-multimonth82ca9ae0c573.jpg XRP is … By Cointelegraph 2025-07-23
XRP Pulls Back After Technical Surge; Pattern Still Points to $6 Target XRP traded in a wide 0.11 range between 3.46 and 3.57 during the 24-hour period ending July 23 at 0800 GMT. The asset posted a 3 swing as bulls drove … By CoinDesk 2025-07-23
XRP Now Larger Than PepsiCo, Uber, Blackrock—And Is Closing in on McDonald’s The cryptocurrency has grown to be larger than some of the biggest firms in the world after setting a new all-time high. By Decrypt 2025-07-23
Dogecoin, Cardano, XRP See Profit-Taking, BNB Crosses $800 as Economists See Lower Chances of July Rate Cut The crypto market is once again knocking on the 4 trillion door but just cant seem to walk through it. Total market capitalization hovered at 3.93 … By CoinDesk 2025-07-23
MARA Holdings Plans $850M Convertible Note Offering to Fuel Bitcoin Buys, Repay Debt Bitcoin miner MARA Holdings MARA said it plans to raise 850 million through a private sale of 0 convertible senior notes due in 2032. The deal, aimed … By CoinDesk 2025-07-23
Crypto adoption in 2025 spurred by payments, AI: Survey !Crypto adoption in 2025 spurred by payments, AI Surveyimagesnewscrypto-adoption-in-2025-spurred-by-payments-ai-sur05c02e2af00c.jpg 37 of survey … By Cointelegraph 2025-07-23
The Market Has Become 'Overly Excited' for Stablecoins, Hong Kong Financial Regulator Says Companies looking to issue stablecoins should rein in their enthusiasm, especially when their main business is unrelated to digital assets, Hong Kong … By CoinDesk 2025-07-23
XRP's July Uptrend Threatened as Bitcoin's $120K Price Resistance Holds This is a daily analysis of top tokens with CME futures by CoinDesk analyst and Chartered Market Technician Omkar Godbole. Bitcoin Rangeplay … By CoinDesk 2025-07-23
'This isn't a top': Here's why Bitcoin analysts say BTC will break $123K !This isnt a top Heres why Bitcoin analysts say BTC will break 123Kimagesnewsthis-isn-t-a-top-here-s-why-bitcoin-analysts-say-bf39edf07f205.jpg … By Cointelegraph 2025-07-23
Altcoins, NFTs Lure Risk-On Buyers: Crypto Daybook Americas By Francisco Rodrigues All times ET unless indicated otherwise The governments announcements of trade agreements with countries including Indonesia … By CoinDesk 2025-07-23
Bitwise CIO on Ether’s ‘Demand Shock’: Why ETH’s Rally Has Staying Power Ethers recent price action may be fueled by more than just sentiment. According to Bitwise Asset Management Chief Investment Officer Matthew Hougan, … By CoinDesk 2025-07-23
'Prince of Darkness' Ozzy Osbourne's Death Sparks Wave of Rug-Pulls on Solana The death of the legendary rockstar Ozzy Osbourne, Prince of Darkness, on Tuesday has triggered a frenzy in the crypto markets. Within hours, … By CoinDesk 2025-07-23
DOJ Blames Court Error After Trump-Linked Crypto Scam Docket Briefly Sealed Interim U.S. Attorney for DC Jeanine Pirro pointed the finger at court clerks for sealing the entire docket rather than a company name. By Decrypt 2025-07-23
CoinShares secures French MiCA license, cementing EU presence !CoinShares secures French MiCA license, cementing EU presenceimagesnewscoinshares-secures-french-mica-license-cementing-e3b45649ab8cb.jpg In … By Cointelegraph 2025-07-23
OpenAI, Oracle expand $500B Stargate spend as Musk unveils bold xAI plan !OpenAI, Oracle expand 500B Stargate spend as Musk unveils bold xAI planimagesnewsopenai-oracle-expand-500b-stargate-spend-as-musk-uaaf2e8cfd0d8.jpg … By Cointelegraph 2025-07-23
Solana's SOL Could Hit $500 in This Bull Run, Says Analyst, as Upexi Boosts Holdings to 1.8M SOL SOL, Solanas native token, hovered just below 200 early Wednesday after a surge of bullish developments including a major corporate accumulation and … By CoinDesk 2025-07-23
Bitcoin speculators hint at 'local bottom' as buyers target $117.5K !Bitcoin speculators hint at local bottom as buyers target 117.5Kimagesnewsbitcoin-speculators-hint-at-local-bottom-as-buyers0d45955e3a2f.jpg Bitcoin … By Cointelegraph 2025-07-23
Fees, collateral give DeFi edge as TradFi eyes crypto loans: 1inch exec !Fees, collateral give DeFi edge as TradFi eyes crypto loans 1inch execimagesnewsfees-collateral-give-defi-edge-as-tradfi-eyes-cryp67b11272816a.jpg … By Cointelegraph 2025-07-23
Grayscale ETF Head David LaValle to Exit as Firm Eyes IPO: Report David LaValle, the global head of ETFs at Grayscale Investments, is set to leave the crypto asset manager at the end of July, Unchained … By CoinDesk 2025-07-23
Ozzy Osbourne’s death sparks 400% surge in CryptoBatz NFTs !Ozzy Osbournes death sparks 400 surge in CryptoBatz NFTsimagesnewsozzy-osbournes-death-sparks-400-surge-in-cryptobat9684b82f43a6.jpg Though modest … By Cointelegraph 2025-07-23
Fartcoin Jumps to Top Ten Based on Derivatives Open Interest, Signals Speculative Frenzy in the Solana-Based Memecoin Need evidence of speculator fervor. Look no further than Coinglass crypto derivatives leaderboardhttpswww.coinglass.com, which shows that fartcoin … By CoinDesk 2025-07-23
South Korean regulator urges asset managers to limit crypto exposure !South Korean regulator urges asset managers to limit crypto exposureimagesnewssouth-korean-regulator-urges-asset-managers-to-limb03fcbfd7b9d.jpg … By Cointelegraph 2025-07-23
Galaxy Positioned to Capture Favorable Regulatory Upside, Jefferies Says as It Initiates With Buy Galaxy Digital GLXY is well positioned to capture upside from the favorable regulatory backdrop for cryptocurrency, Jefferies said in a new research … By CoinDesk 2025-07-23
Colorado pastor and wife indicted in $3.4M crypto scam !Colorado pastor and wife indicted in 3.4M crypto scamimagesnewscolorado-pastor-and-wife-indicted-in-3-4m-crypto-sd4168a2db525.jpg The pastor claimed … By Cointelegraph 2025-07-23
Crypto Asset Manager CoinShares Secures EU-Wide MiCA License CoinShares CS said it received a license under the European Unions Markets in Crypto Assets MiCA regulation, the first crypto asset manager based in … By CoinDesk 2025-07-23
Spot Ether ETFs attract $533M, extend 13-day inflow streak to over $4B !Spot Ether ETFs attract 533M, extend 13-day inflow streak to over 4Bimagesnewsspot-ether-etfs-attract-533m-extend-13-day-inflow-328a60f665d1.jpg … By Cointelegraph 2025-07-23
Disguised Unemployment in Blockchain? Data Shows Only 12% of Ethereum, 25% of Solana Protocols Have Revenue Have you heard of disguised unemployment? It refers to a situation where a portion of the workforce appears to be employed, but isnt contributing to … By CoinDesk 2025-07-23
Japan's Kitabo Joins Growing List of Asian Firms Turning to Bitcoin Amid Financial Strain Kitabo cited growing regulatory clarity and Bitcoins establishment as a key asset following its U.S. ETF listing as reasons for the move. By Decrypt 2025-07-23
US looks to grab $7.1M in crypto from oil and gas investment scam !US looks to grab 7.1M in crypto from oil and gas investment scamimagesnewsus-looks-to-grab-7-1m-in-crypto-from-oil-and-gas-i10de4fcac531.jpg Federal … By Cointelegraph 2025-07-23
Backed Finance's Tokenized Stocks Product Volume Jumps to $300M Demand for trading stocks on-chain is real. Switzerland-based Backed Finances tokenized U.S. equities product, xStocks, has seen a cumulative trading … By CoinDesk 2025-07-23
DOJ Seeks to Return Millions in Crypto to Alleged Victims of $97M Oil and Gas Scheme Federal prosecutors say funds from a 97 million oil and gas scam were laundered through shell companies, crypto wallets, and exchanges. By Decrypt 2025-07-23
Crypto traders with ‘emotionless approach’ to do well this cycle — Exec !Crypto traders with emotionless approach to do well this cycle Execimagesnewscrypto-traders-with-emotionless-approach-to-do-wel981e95ff6da3.jpg As … By Cointelegraph 2025-07-23
Bank of England mulls canning CBDC plan: Report !Bank of England mulls canning CBDC plan Reportimagesnewsbank-of-england-mulls-canning-cbdc-plan-report4628b6fc6a3b.jpg The UK central bank is … By Cointelegraph 2025-07-23
DOGE Volume Spikes 75% Above Average as Traders Defend $0.26 Floor Dogecoin rallied sharply in the face of global macro uncertainty, climbing 5 during the 24-hour session ending July 23 at 0500 GMT. The move came as … By CoinDesk 2025-07-23
XRP Climbs 4% on Triangle Breakout, Holds $3.50 Amid Profit-Taking XRP posted a 4 gain during the 24-hour trading window from July 22 at 0300 to July 23 at 0200, with prices moving between a low of 3.42 and a high of … By CoinDesk 2025-07-23
Dogecoin Could Soon Verify ZK Proofs Natively, Thanks to DogeOS Push Dogecoin mightve started as a joke, but this upgrade isnt one. DogeOS, the app layer developed by the MyDoge wallet team, has submitted a formal … By CoinDesk 2025-07-23
SEC approves, then instantly pauses Bitwise’s ETF conversion !SEC approves, then instantly pauses Bitwises ETF conversionimagesnewssec-approves-then-instantly-pauses-bitwises-etf-co5dbcd6da38db.jpg SEC … By Cointelegraph 2025-07-23
Here's Why Ethereum ETF Investors Are Outperforming Their Bitcoin Counterparts Ethereums rally and surging ETF inflows are leading its investors to outperform Bitcoin holders, backed by growing institutional interest. By Decrypt 2025-07-23
ASX-Listed DigitalX Leans Into Bitcoin Treasury Strategy With Latest $8.8M Buy The firm now holds nearly 500 Bitcoin, joining a growing list of companies adding Bitcoin to their balance sheets. By Decrypt 2025-07-23
South Korea Tells Firms to Cut Exposure to Crypto ETFs, Coinbase and Strategy: Report South Koreas finance regulator has informally warned local asset managers to reduce their exposure to crypto exchange-traded funds ETF and … By CoinDesk 2025-07-23
21Shares files with SEC for spot ONDO ETF !21Shares files with SEC for spot ONDO ETFimagesnews21shares-files-with-sec-for-spot-ondo-etfc01d687f5607.jpg 21Shares has filed a preliminary … By Cointelegraph 2025-07-23
Bitcoin hitting $200K this year ‘very improbable,’ says analyst !Bitcoin hitting 200K this year very improbable, says analystimagesnewsbitcoin-hitting-200k-this-year-very-improbable-sayf9f65509509a.jpg Glassnode … By Cointelegraph 2025-07-23
UK to ban public sector from making ransomware payments !UK to ban public sector from making ransomware paymentsimagesnewsuk-to-ban-public-sector-from-making-ransomware-pay27486ee2128f.jpg The UK will … By Cointelegraph 2025-07-23
‘Bizarre Situation’: SEC Halts Conversion for Another ETF Holding Bitcoin, Ethereum, and XRP The SEC has stepped in to pause Bitwises approved crypto ETF just hours after staff gave it the green light. By Decrypt 2025-07-23
Asia Morning Briefing: The First AI vs BTC Environmental Impact Numbers are Here. And it Might Start a New Debate Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-07-23
Tesla’s Retro Diner Opens in Los Angeles with Burgers, Big Screens and Angry Neighbors Visitors waited hours to try the 250-seat venue, where movies play during charge times and Musks humanoid robot hands out popcorn. By Decrypt 2025-07-23
$100B Binance Futures volume backs traders’ ‘altseason’ claim !100B Binance Futures volume backs traders altseason claimimagesnews100b-binance-futures-volume-backs-traders-altseasofb818a5a84f1.jpg Altseason … By Cointelegraph 2025-07-22
Can Bitcoin Hold Above $120K? Bulls and Bears Are Split Can BTC bulls close out the week in the green? The odds on the Myriad prediction market are nearly dead even. By Decrypt 2025-07-22
Can AI Solve the Dick Pic Epidemic? Dating app Flirtini launches an AI coach to teach men how to flirt without flashing. By Decrypt 2025-07-22
Bitfarms to buy back 10% of shares, calls stock undervalued !Bitfarms to buy back 10 of shares, calls stock undervaluedimagesnewsbitfarms-to-buy-back-10-of-shares-calls-stock-unded1135d0eb0d6.jpg The bitcoin … By Cointelegraph 2025-07-22
Bitcoin liquidity wars carry on, but BTC price target remains $140K !Bitcoin liquidity wars carry on, but BTC price target remains 140Kimagesnewsbitcoin-liquidity-wars-carry-on-but-btc-price-targf23665ba790a.jpg … By Cointelegraph 2025-07-22
Bitcoin, Ethereum ETF Issuers Likely to Get SEC Approval for In-Kind Redemptions: Analyst Following a recent spate of filings from issuers to add in-kind redemptions to their Bitcoin and Ethereum ETFs, a Bloomberg analyst says progress is … By Decrypt 2025-07-22
Crypto confusion: 50% of non-investors don’t understand it well enough to buy !Crypto confusion 50 of non-investors dont understand it well enough to … By Cointelegraph 2025-07-22
FBI Ends Investigation Into Kraken Founder Jesse Powell: Report Feds have dropped an investigation into Kraken co-founder Jesse Powell, he said Tuesday, over allegations levied by a nonprofit he started. By Decrypt 2025-07-22
Dan Tapiero Projects Crypto Economy Hitting $50T, Launches $500M Fund Under New Firm Well-known digital asset investor Dan Tapiero is merging private equity firms 10T Holdings and 1RoundTable Partners under a new brand 50T, reflecting … By CoinDesk 2025-07-22
SEC Approves, Immediately Pauses Bitwise's Bid to Convert BITW Crypto Index Fund to ETF The Securities and Exchange Commission approved then abruptly … By CoinDesk 2025-07-22
Price predictions 7/22: SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE !Price predictions 722 SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPEimagesnewsprice-predictions-7-22-spx-dxy-btc-eth-xrp-bnb-sol4462ca395b41.jpg … By Cointelegraph 2025-07-22
Circle Downgraded to ‘Sell’ by Compass Point After Trump Signs Stablecoin Bill The analysts expect more competition from traditional financial services organizations who are diving into stablecoin initiatives amid an improved … By Decrypt 2025-07-22
Boom in RWA tokenization expected after passing of GENIUS Act — Aptos exec !Boom in RWA tokenization expected after passing of GENIUS Act Aptos … By Cointelegraph 2025-07-22
Elon Musk’s SpaceX Moves Bitcoin Holdings for First Time in 3 Years The aerospace firm consolidated its Bitcoin tokens that were stored in 16 wallets into a single on-chain wallet. By Decrypt 2025-07-22
Ethereum Validator Exit Queue Nears $2B as Stakers Rush to Exit After 160% Rally Ethereums validator exit queue swelled on Tuesday to its longest wait time in more than a year, that could signal a rush among stakers to pull funds … By CoinDesk 2025-07-22
PNC Bank to launch crypto trading via Coinbase partnership !PNC Bank to launch crypto trading via Coinbase partnershipimagesnewspnc-bank-to-launch-crypto-trading-via-coinbase-par40890a61e3e6.jpg Institutional … By Cointelegraph 2025-07-22
Solana SSK ETF breaks $100M as Wall Street warms to crypto staking !Solana SSK ETF breaks 100M as Wall Street warms to crypto stakingimagesnewssolana-ssk-etf-breaks-100m-as-wall-street-warms-toe97b4b80474a.jpg SSK, … By Cointelegraph 2025-07-22
Crypto Prediction Market Polymarket Weighs Launching Its Own Stablecoin: Source Polymarket, the cryptocurrency-powered prediction market that recently attained a billion dollar … By CoinDesk 2025-07-22
The Node: JPM’s BTC Lending Play The Financial Times reportshttpswww.coindesk.commarkets20250722jpmorgan-plans-to-launch-crypto-backed-loans-report that JPMorgan, the worlds biggest … By CoinDesk 2025-07-22
FBI Drops Criminal Probe Into Kraken Founder Jesse Powell Federal authorities have dropped a criminal investigation into Jesse Powell, co-founder and former CEO of cryptocurrency exchange Kraken. The FBI … By CoinDesk 2025-07-22
Bitfarms Stock Jumps After Bitcoin Miner Reveals $64 Million Share Buyback Plan The Nasdaq-listed shares of Bitcoin miner Bitfarms pumped Tuesday after the Canadian company announced a share buyback program. By Decrypt 2025-07-22
Ethereum Treasury SharpLink's Holdings Reach $1.3 Billion With Latest ETH Purchase The firms share price was up more than 10 on Tuesday. The firm bought nearly 80,000 ETH over the weekend. By Decrypt 2025-07-22
Opendoor’s 500% surge signals return of meme stock mania !Opendoors 500 surge signals return of meme stock maniaimagesnewsopendoors-500-surge-signals-return-of-meme-stock-m89cf738aca2d.jpg Meme stocks are … By Cointelegraph 2025-07-22
Toncoin Extends Rally as Telegram Launches Integrated TON Wallet for 87M U.S. Users Toncoin TON extended its impressive rally Monday after Telegram began rolling out its TON Wallet to 87 million users across the United States. The … By CoinDesk 2025-07-22
Microsoft publishes emergency patches for its SharePoint software amid attacks !Microsoft publishes emergency patches for its SharePoint software amid … By Cointelegraph 2025-07-22
US Senate Republicans release draft bill for crypto market structure !US Senate Republicans release draft bill for crypto market structureimagesnewsus-senate-republicans-release-draft-bill-for-crypta59339a58c1c.jpg … By Cointelegraph 2025-07-22
London Gang Convicted of Kidnapping Barber They Thought Was a Bitcoin Billionaire—He Wasn't London gang jailed for kidnapping barber over fake crypto fortunehe only had 9, so they settled for 2.7k. By Decrypt 2025-07-22
SpaceX moves $153M in BTC after three-year silence !SpaceX moves 153M in BTC after three-year silenceimagesnewsspacex-moves-153m-in-btc-after-three-year-silence4b45d85f64f5.jpg SpaceX transferred 153 … By Cointelegraph 2025-07-22
BitMine Immersion Rises After ARK Invest Buys $182 Million in Ethereum Treasury Shares BitMine Immersion shares were up a day after Cathie Woods ARK Invest purchased 182 million of the Ethereum treasury companys stock. By Decrypt 2025-07-22
Tokenized Stocks Expose a Major Tax Reporting Gap in Crypto—Robin Singh Global crypto tax reporting still has major cracks and tokenized stocks may be the catalyst that forces the system to catch up. In recent weeks, … By CoinDesk 2025-07-22
TRUMP MEDIA DISCLOSES $2B OF BTC, KAITO INTRODUCES CAPITAL LAUNCHPAD, JPMORGAN LENDING AGAINST BTC & ETH? SOL outperforms on MEV elimination upgrade. Altcoins searches hit 4 year high. ETH ETF inflows continue outperforming BTC. JP Morgan exploring loans … By Decrypt 2025-07-22
Privacy Is Key to the Next Phase of Ethereum Ethereum introduced smart contracts to the world and spurred a Cambrian Explosion of innovation, including DeFi, NFTs, DAOs, and a universe of dApps. … By CoinDesk 2025-07-22
The dead don’t spend Bitcoin: How to set up a crypto inheritance plan (before it’s too late) !The dead dont spend Bitcoin How to set up a crypto inheritance plan before its too … By Cointelegraph 2025-07-22
Citadel warns SEC: Tokenization must deliver real innovation, not regulatory loopholes !Citadel warns SEC Tokenization must deliver real innovation, not regulatory … By Cointelegraph 2025-07-22
CryptoPunks Lead as NFT Trading Volume Rebounds on Solana and Ethereum The NFT market has cooled drastically in recent years, but a flurry of CryptoPunk sales has brought renewed attention to the space. By Decrypt 2025-07-22
PEPE Dips Slightly as Market Cools, but Outperforms Broader Memecoin Sector PEPE fell around 2 in the last 24-hour period as part of a broader 5 sell-off that started amid a crypto market slowdown and a wave of high-volume … By CoinDesk 2025-07-22
FBI ends probe of Kraken co-founder, returns confiscated devices — Report !FBI ends probe of Kraken co-founder, returns confiscated devices Reportimagesnewsfbi-ends-probe-of-kraken-co-founder-returns-confis557665596222.jpg … By Cointelegraph 2025-07-22
ATOM Slips 5% as Bitcoin Regains Dominance After Altcoin Season ATOM, the native token of the Cosmos network, tumbled 5 in the past 24 hours as Bitcoin regained momentum, pulling market attention back to large-cap … By CoinDesk 2025-07-22
The Senate Must Finish the Job on America’s Pro-Crypto Future—Emmer, Begich President Trump ran and won on a bold promise to make America the global capital of cryptocurrency and blockchain innovation. Now, with a Republican … By CoinDesk 2025-07-22
Pump.fun's Solana Token Falls Below ICO Price as Hype Cools Ahead of PUMP Airdrop Pump.fun users appear to be getting restless while awaiting an airdrop, with the PUMP token falling to a record low price Tuesday. By Decrypt 2025-07-22
Senate Releases Answer to Clarity Act as It Continues Market Structure Work The U.S. Senate is marching on in its effort to craft rules and regulations for the vast majority of the crypto market, releasing a discussion draft … By CoinDesk 2025-07-22
BNB Drops After Failed Breakout, Key Support Holds as Corporate Accumulation Grows BNBs price slipped nearly 1.5 in volatile trading over the last 24-hour period to trade recently around 765. Its down from a near 780 high earlier … By CoinDesk 2025-07-22
A16z Crypto leads $15M Poseidon raise to decentralize AI training data !A16z Crypto leads 15M Poseidon raise to decentralize AI training dataimagesnewsa16z-crypto-leads-15m-poseidon-raise-to-decentrali4c5206d8bc2e.jpg … By Cointelegraph 2025-07-22
A16z Crypto Leads $15M Seed Round Into Decentralized AI Data Layer Poseidon Venture capital heavyweight a16z Crypto led a 15 million seed-round investment into Poseidon, a decentralized artificial intelligence AI data layer. … By CoinDesk 2025-07-22
EDX Unveils International Crypto Trading Platform With Perpetual Futures EDX, which operates an institutional focused crypto exchange in the … By CoinDesk 2025-07-22
ETH to $4,000? Analysts Weigh Whale Purchases Against Correction Risks Ethers multi-week climb toward the 4,000 level has faced resistance, with the token falling more than 3 to around 3,696. While bulls remain confident … By CoinDesk 2025-07-22
Internet Computer Slides Amid Broader Altcoin Pullback Internet Computer ICP dropped 4.85 to 5.9149 on Tuesday, posting a low of 5.81 after peaking at 6.25httpswww.coindesk.compriceinternet-computer the … By CoinDesk 2025-07-22
BONK Holds Key Support as Volatility Grips Market BONK traded in a wide 8 range from 0.0000328 to 0.0000358 between July 21 and July 22, ultimately falling 4 lower at … By CoinDesk 2025-07-22
What does the US GENIUS Act mean for stablecoins? !What does the US GENIUS Act mean for stablecoins?imagesnewswhat-does-the-us-genius-act-mean-for-stablecoins0cbf2762e930.jpg The Genius Act is a US … By Cointelegraph 2025-07-22
Bitcoin ETFs' 12-Day Inflow Streak Comes to an End as Price Stalls U.S.-listed spot bitcoin exchange-traded funds saw net outflows of 131.4 million on Monday, breaking a 12-day streak of uninterrupted inflows that … By CoinDesk 2025-07-22
UK Says Crypto Sector Likely Under Reporting Sanction Breaches Crypto companies in the U.K. have almost certainly been under-reporting breaches of financial sanctions since as far back as 2022, the Office of … By CoinDesk 2025-07-22
NEAR Slumps as Bitcoin Regains Strength, Ending Altcoin Surge NEAR Protocol slid sharply on Monday as intense selling pressure gripped the market, with the token breaking critical support levels despite surging … By CoinDesk 2025-07-22
Telegram Users in US Can Now Access Native Crypto Wallet American users of popular messaging app Telegram can now access the native crypto wallet app that launched elsewhere in 2023. By Decrypt 2025-07-22
SOL NEARS $200, JP MORGAN LOOKS AT CRYPTO LOANS, FARTCOIN LEADS MEMES SOL outperforms on MEV elimination upgrade. Altcoins searches hit 4 year high. ETH ETF inflows continue outperforming BTC. JP Morgan exploring loans … By Decrypt 2025-07-22
Kraken to Support Biotech Firm Windtree’s $200M BNB Treasury Play Nasdaq-listed biotech firm Windtree Therapeutics has entered into a strategic partnership with crypto exchange Kraken to manage its BNB-focused … By CoinDesk 2025-07-22
Crypto needs minimum viable decentralization to guide performance-focused infrastructure !Crypto needs minimum viable decentralization to guide performance-focused … By Cointelegraph 2025-07-22
Why XRP Army Members Are 'Fucking Furious' About the All-Time High XRP just broke its seven-year-old price record, but die-hard fans believe that the SECs legal battle with Ripple has stunted its growth. By Decrypt 2025-07-22
PNC Bank to Offer Crypto Access Through Coinbase Amid Growing Institutional Demand PNC Bank PNC is partnering with Coinbase COIN to offer its institutional and banking clients access to cryptocurrency services, the companies … By CoinDesk 2025-07-22
New Bitcoin analysis says ‘most explosive phase’ to $140K is close !New Bitcoin analysis says most explosive phase to 140K is closeimagesnewsnew-bitcoin-analysis-says-most-explosive-phase-to-79d46f74a2b9.jpg Bitcoin … By Cointelegraph 2025-07-22
Owning a full Bitcoin in 2025 — just how rare is it? !Owning a full Bitcoin in 2025 just how rare is it?imagesnewsowning-a-full-bitcoin-in-2025-just-how-rare-is-it2f795d5aba63.jpg Fewer than 1 million … By Cointelegraph 2025-07-22
Bitcoin Miner Bitfarms Jumps 8% on Share Buyback Program Bitcoin mining firm Bitfarms BITF surged on Tuesday as the company … By CoinDesk 2025-07-22
PancakeSwap Infinity launches on Base as L2 network hits record TVL !PancakeSwap Infinity launches on Base as L2 network hits record TVLimagesnewspancakeswap-infinity-launches-on-base-as-l2-networ41868b479fd2.jpg … By Cointelegraph 2025-07-22
TON Wallet goes live for Telegram users in US !TON Wallet goes live for Telegram users in USimagesnewston-wallet-goes-live-for-telegram-users-in-us39f49254d842.jpg Telegram rolls out TON Wallet … By Cointelegraph 2025-07-22
Sharplink buys $259M in Ether as ETH accumulation race heats up !Sharplink buys 259M in Ether as ETH accumulation race heats upimagesnewssharplink-buys-259m-in-ether-as-eth-accumulation-r075edacb9c14.jpg SharpLink … By Cointelegraph 2025-07-22
Western Union joins stablecoin race, eyes crypto partnerships: CEO !Western Union joins stablecoin race, eyes crypto partnerships CEOimagesnewswestern-union-joins-stablecoin-race-eyes-crypto-pa54dcbab4c1e8.jpg … By Cointelegraph 2025-07-22
The AI Gig Economy Is Here—And It Pays in Crypto Sahara AIs new bounty platform rewards users for labeling training data, with over 450K in token payouts By Decrypt 2025-07-22
Dogecoin Could Get a Massive Network Upgrade—Here's How Dogecoin could rival the likes of Ethereum and Solana, developers say, if a new network upgrade proposal is passed and implemented. By Decrypt 2025-07-22
Pump.fun private sale investors send over $160M to exchanges !Pump.fun private sale investors send over 160M to exchangesimagesnewspump-fun-private-sale-investors-send-over-160m-to-29568422e3c3.jpg Pump.fun … By Cointelegraph 2025-07-22
Bitcoin seller exhaustion 'likely' as trader eyes $115K BTC price dip !Bitcoin seller exhaustion likely as trader eyes 115K BTC price dipimagesnewsbitcoin-seller-exhaustion-likely-as-trader-eyes-113bc907b92d28.jpg … By Cointelegraph 2025-07-22
Altcoins Including Ethereum, Dogecoin Slip as Market Cools Off Hedera and Hyperliquid led losses among the top 20 as altcoins entered a cooling off period after overbought signals, Decrypt was told. By Decrypt 2025-07-22
Ethereum whale nets $9.87M profit as ETH snaps 8-day winning streak !Ethereum whale nets 9.87M profit as ETH snaps 8-day winning streakimagesnewsethereum-whale-nets-9-87m-profit-as-eth-snaps-8-dab04b5469d619.jpg Ether … By Cointelegraph 2025-07-22
Bitget Wallet launches first fiat withdrawal option via MoonPay !Bitget Wallet launches first fiat withdrawal option via MoonPayimagesnewsbitget-wallet-launches-first-fiat-withdrawal-optio115d72885ce2.jpg Bitget … By Cointelegraph 2025-07-22
XRP price breaks out: These charts predict rally toward $6 !XRP price breaks out These charts predict rally toward 6imagesnewsxrp-price-breaks-out-these-charts-predict-rally-to55f4a973bfac.jpg Multiple … By Cointelegraph 2025-07-22
Genius Group cites GENIUS Act as it boosts Bitcoin stash to 200 BTC !Genius Group cites GENIUS Act as it boosts Bitcoin stash to 200 BTCimagesnewsgenius-group-cites-genius-act-as-it-boosts-bitcoinf53ffe808816.jpg … By Cointelegraph 2025-07-22
JPMorgan exploring crypto-backed loans amid stablecoin push: FT !JPMorgan exploring crypto-backed loans amid stablecoin push FTimagesnewsjpmorgan-exploring-crypto-backed-loans-amid-stable6fd7110be2fc.jpg The … By Cointelegraph 2025-07-22
Cryptojacking Resurfaces As Monero Miner Malware Hits 3,500+ Sites: Report A quiet wave of browser-based crypto miners is spreading across the web, repurposing compromised sites from older attacks. By Decrypt 2025-07-22
Strategy launches Bitcoin stock pegged at $100 to increase treasury !Strategy launches Bitcoin stock pegged at 100 to increase treasuryimagesnewsstrategy-launches-bitcoin-stock-pegged-at-100-to-i8a8a32161598.jpg … By Cointelegraph 2025-07-22
Spot Bitcoin ETFs break 12-day inflow streak amid ‘profit taking’ !Spot Bitcoin ETFs break 12-day inflow streak amid profit takingimagesnewsspot-bitcoin-etfs-break-12-day-inflow-streak-amid-b88e24ca00e1.jpg Spot … By Cointelegraph 2025-07-22
JPMorgan Exploring Loans Backed by Bitcoin, Ethereum: FT The Wall Street giant may allow clients to borrow against crypto holdings, such as Bitcoin and Ethereum, as early as next year. By Decrypt 2025-07-22
Cathie Wood sells Coinbase, Roblox shares for Tom Lee’s ETH firm !Cathie Wood sells Coinbase, Roblox shares for Tom Lees ETH firmimagesnewscathie-wood-sells-coinbase-roblox-shares-for-tom-l2f1884de97a3.jpg ARK … By Cointelegraph 2025-07-22
Eric Trump takes victory lap 5 months after telling everyone to buy ETH !Eric Trump takes victory lap 5 months after telling everyone to buy ETHimagesnewseric-trump-takes-victory-lap-5-months-after-tellinff1607972402.jpg … By Cointelegraph 2025-07-22
Solana Clinches 5-Month High, Where to From Here? Solana hit a five-month high amid surging open interest, though macro headwinds and technicals point to a mixed near-term outlook. By Decrypt 2025-07-22
Chinese pork producer turned BTC miner kicks off Dogecoin plan !Chinese pork producer turned BTC miner kicks off Dogecoin planimagesnewschinese-pork-producer-turned-btc-miner-kicks-off-d56ee7b678183.jpg Bit … By Cointelegraph 2025-07-22
Republicans propose 7% leaner SEC budget compared to Biden’s era !Republicans propose 7 leaner SEC budget compared to Bidens eraimagesnewsrepublicans-propose-7-leaner-sec-budget-compared-tb2615a1c7627.jpg House … By Cointelegraph 2025-07-22
Coinbase Follows Kraken's Lead, Opens Perpetuals Trading for US Customers Coinbases new contracts offer 5-year durations while touting lower fees, as it aims to lure U.S. traders from offshore platforms. By Decrypt 2025-07-22
Western Union Eyes Stablecoins as Remittance Giants Face Outward Pressure Western Union joins a growing list of firms exploring stablecoins as the GENIUS Act brings new clarity to U.S. regulations. By Decrypt 2025-07-22
Can Trump Fire Fed Chair Jerome Powell—And What Does That Mean For Crypto? Crypto traders are eyeing rate cuts this year amid a growing standoff between President Trump and Fed Chair Jerome Powell. By Decrypt 2025-07-22
Ether Machine founder claims ETH outperformed BTC over past 10 years !Ether Machine founder claims ETH outperformed BTC over past 10 yearsimagesnewsether-machine-founder-claims-eth-outperformed-btc-ccfb35ff67de.jpg … By Cointelegraph 2025-07-22
DeFi Development Corp hits 999,999 SOL, Solana soars 12% !DeFi Development Corp hits 999,999 SOL, Solana soars 12imagesnewsdefi-development-corp-hits-999999-sol-solana-soars28d10f797f43.jpg DeFi Development … By Cointelegraph 2025-07-22
Roman Storm could go for mistrial over scam victim’s testimony: Report !Roman Storm could go for mistrial over scam victims testimony Reportimagesnewsroman-storm-could-go-for-mistrial-over-scam-victim4725612f84e7.jpg … By Cointelegraph 2025-07-22
Ring Users Report Mysterious Logins—Amazon Blames Backend Bug Users spotted suspicious Amazon Ring logins dated May 28, days after the companys founder rejoined to make neighborhoods safer. By Decrypt 2025-07-21
Tornado Cash Trial Takes a Turn as Roman Storm's Lawyers Mull Mistrial Storms lawyers said Monday that uncertainties over Tornado Cashs role in some of the events recounted by witnesses could be grounds for a mistrial. By Decrypt 2025-07-21
Crypto ATMs seized in the UK amid growing scrutiny of kiosk-based exchanges !Crypto ATMs seized in the UK amid growing scrutiny of kiosk-based … By Cointelegraph 2025-07-21
Judge allows testimony on ‘feasible’ Tornado Cash code changes !Judge allows testimony on feasible Tornado Cash code changesimagesnewsjudge-allows-testimony-on-feasible-tornado-cash-co5c842edffdd5.jpg The second … By Cointelegraph 2025-07-21
The Business of Memes: Inside the Solana Meme Coin Factory Pump.Fun Pump.fun has generated 774 million in revenue, raised 600 million in 12 minutes, and created almost 12 million tokens on Solana. Can it keep it going? By Decrypt 2025-07-21
Hive Digital accelerates AI pivot with $100M HPC expansion — Cointelegraph exclusive !Hive Digital accelerates AI pivot with 100M HPC expansion Cointelegraph … By Cointelegraph 2025-07-21
Strategy Reveals Another Stock Offering to Boost $71 Billion Bitcoin Stash Bitcoin treasury firm Strategy formerly MicroStrategy is launching a new financial product as a way to raise money for BTC buys. By Decrypt 2025-07-21
Polymarket set to reenter US with $112M acquisition of QCEX derivatives exchange !Polymarket set to reenter US with 112M acquisition of QCEX derivatives … By Cointelegraph 2025-07-21
Robinhood CEO Acknowledges OpenAI Crypto Stock 'Controversy'—But Is Doubling Down Vlad Tenev said Robinhood is dead set on expanding its tokenized stock offerings, despite warnings from the SEC about the novel asset class. By Decrypt 2025-07-21
What the DOGE? Why Dogecoin Has Jumped 40% in a Week The Elon Musk favorite is the biggest gainer over the past week among the top 20 cryptocurrencies by market value. By Decrypt 2025-07-21
StablecoinX to go public via SPAC merger, raising $360M for ENA treasury !StablecoinX to go public via SPAC merger, raising 360M for ENA treasuryimagesnewsstablecoinx-to-go-public-via-spac-merger-raising-334f9ba4d256b.jpg … By Cointelegraph 2025-07-21
To the moon? Justin Sun to be launched into space after $28M bid !To the moon? Justin Sun to be launched into space after 28M bidimagesnewsto-the-moon-justin-sun-to-be-launched-into-space-aab4080283a3f.jpg The Blue … By Cointelegraph 2025-07-21
FTX seeks time to respond as creditors fight freeze on $470M foreign claims !FTX seeks time to respond as creditors fight freeze on 470M foreign … By Cointelegraph 2025-07-21
Altcoins Unleashed: Ethereum, XRP and Dogecoin Ignite Rally as Crypto Tops $4 Trillion WAGMI? Altcoins are heating up as Bitcoin cools down. By Decrypt 2025-07-21
Ethereum Is So Back? ETH Price Jumps to 2025 High Amid Open Interest Surge Ethereum has spiked 26 over the past week as investors pour into ETFs and public companies establish ETH treasuries. By Decrypt 2025-07-21
Bit Origin Buys Millions in Dogecoin After Revealing $500M Raise for DOGE Treasury Bitcoin mining infrastructure firm Bit Origin is going hard on Dogecoin, starting to buy up DOGE for its meme coin treasury. By Decrypt 2025-07-21
Polymarket Eyes US Return via $112 Million Crypto Exchange Acquisition Although activity has cooled since Election Day, Polymarket registered 1.1 trillion in trading volume in June. By Decrypt 2025-07-21
Stablecoin or CBDC? Tether’s latest freeze adds fuel to decentralization debate !Stablecoin or CBDC? Tethers latest freeze adds fuel to decentralization … By Cointelegraph 2025-07-21
UK Chancellor Mulls Selling $7.2B Bitcoin Stash to Plug Gap in National Finances Trade association CryptoUK urged the government to take a long-term view on holding Bitcoin seized from criminals. By Decrypt 2025-07-21
Trump’s media company reports $2B in Bitcoin after crypto bills pass US House !Trumps media company reports 2B in Bitcoin after crypto bills pass US … By Cointelegraph 2025-07-21
'Sick to My Stomach': Why Dave Portnoy Fumbled His XRP Bag Before the Boom Barstool Sports founder Dave Portnoy said he missed out on millions by dumping his XRP before the record surge. Heres why he sold. By Decrypt 2025-07-21
Bitcoin bull run 'likely close to over' says trader as XRP flips McDonald's !Bitcoin bull run likely close to over says trader as XRP flips McDonaldsimagesnewsbitcoin-bull-run-likely-close-to-over-says-trader-43d85701a67e.jpg … By Cointelegraph 2025-07-21
'Ethereum Avengers' Firm to Generate ETH Using $1.5 Billion Stockpile The firm received a 645 million anchor investment from its Consensys-linked co-founder and chair. By Decrypt 2025-07-21
Trump Media Buys $2 Billion in Bitcoin, BTC Securities for Treasury The company, which owns the Truth Social social media platform and has struggled financially, joins a growing number of companies to create Bitcoin … By Decrypt 2025-07-21
Trump’s Bitcoin mentor bet on BTC treasury strategies — and his wealth is exploding !Trumps Bitcoin mentor bet on BTC treasury strategies and his wealth is … By Cointelegraph 2025-07-21
Pro-Israel hackers took $81M in crypto — but it wasn’t about the money !Pro-Israel hackers took 81M in crypto but it wasnt about the moneyimagesnewspro-israel-hackers-took-81m-in-crypto-but-it-wasnt15c557604536.jpg A … By Cointelegraph 2025-07-21
SOL LEADS MAJORS, NFTS HEAT-UP, BIG WEEK FOR EARNINGS BTC dominance slides by largest margin in 3 years. SOL hits 100bn, leads majors in catch-up trade. ETH ETF inflows again surpass BTC. 40 of ETH ETF … By Decrypt 2025-07-21
BitGo Is Latest Crypto Firm to File for IPO Following Circle's Massive Debut Digital assets services and custody firm BitGo plans to go public, revealing a confidential filing with the SEC on Monday. By Decrypt 2025-07-21
Solana price paints 'textbook' chart pattern for potential rally to $6K !Solana price paints textbook chart pattern for potential rally to 6Kimagesnewssolana-price-paints-textbook-chart-pattern-for-pot1a0684cd4b5f.jpg … By Cointelegraph 2025-07-21
'Ethereum Stole the Show' as ETH ETF Flows Hit Record High: CoinShares Ethereum ETFs smash records with 2.2B weekly inflows, outshining Bitcoin as institutional investors pile into the surging altcoin. By Decrypt 2025-07-21
Progressives are losing the crypto future !Progressives are losing the crypto futureimagesnewsprogressives-are-losing-the-crypto-futureb637510c11c6.jpg As US conservatives rapidly shape the … By Cointelegraph 2025-07-21
Strategy Boosts Bitcoin Holdings With Latest $739.8 Million BTC Purchase The company bought Bitcoin at an average price of 118,940 per coin last week. By Decrypt 2025-07-21
The $3.5B shift: How Bitcoin miners are cashing in on AI !The 3.5B shift How Bitcoin miners are cashing in on AIimagesnewsthe-3-5b-shift-how-bitcoin-miners-are-cashing-in-o917d15bb8857.jpg From GPUs to AI … By Cointelegraph 2025-07-21
Indian Crypto Exchange CoinDCX Launches Bounty Hunt After $44 Million Exploit Security firms such as Sygnia and Seal911, along with Solana and Wormhole, are aiding CoinDCX in tracing and freezing stolen funds. By Decrypt 2025-07-21
Aave proposal to launch centralized lending on Kraken’s Ink moves to next phase !Aave proposal to launch centralized lending on Krakens Ink moves to next … By Cointelegraph 2025-07-21
BitGo files for US IPO as crypto custody business surpasses $100B !BitGo files for US IPO as crypto custody business surpasses 100Bimagesnewsbitgo-files-for-us-ipo-as-crypto-custody-business-398f3ab2fad6.jpg BitGo … By Cointelegraph 2025-07-21
Ethereum NFTs dominate 7-day sales rankings as ETH nears $4K !Ethereum NFTs dominate 7-day sales rankings as ETH nears 4Kimagesnewsethereum-nfts-dominate-7-day-sales-rankings-as-eth954550228d57.jpg CryptoPunks … By Cointelegraph 2025-07-21
Bitcoin’s quantum countdown has already begun, Naoris CEO says !Bitcoins quantum countdown has already begun, Naoris CEO saysimagesnewsbitcoins-quantum-countdown-has-already-begun-naorib5a9c0addb37.jpg A veteran … By Cointelegraph 2025-07-21
Pudgy Penguins Solana Token PENGU Jumps Double Digits Amid NFT Sweep An unknown user bought 45 CryptoPunks, causing major NFT collections to surgeincluding Pudgy Penguins and its Solana token. By Decrypt 2025-07-21
CoinDCX announces white hat recovery bounty after $44M hack !CoinDCX announces white hat recovery bounty after 44M hackimagesnewscoindcx-announces-white-hat-recovery-bounty-after-7b32772d46db.jpg The Indian … By Cointelegraph 2025-07-21
COINS Act model law offers blueprint for crypto regulation in India !COINS Act model law offers blueprint for crypto regulation in Indiaimagesnewscoins-act-model-law-offers-blueprint-for-crypto-re8ed312cf4b5b.jpg … By Cointelegraph 2025-07-21
Strategy adds $740M of Bitcoin as price surges past $122K !Strategy adds 740M of Bitcoin as price surges past 122Kimagesnewsstrategy-adds-740m-of-bitcoin-as-price-surges-past6ebb9b0ef350.jpg Michael Saylors … By Cointelegraph 2025-07-21
Chinese blockchain Conflux launching offshore yuan-backed stablecoin !Chinese blockchain Conflux launching offshore yuan-backed stablecoinimagesnewschinese-blockchain-conflux-launching-offshore-yuan60e65fb69c66.jpg … By Cointelegraph 2025-07-21
Ether Machine to launch $1.5B institutional ETH yield fund !Ether Machine to launch 1.5B institutional ETH yield fundimagesnewsether-machine-to-launch-1-5b-institutional-eth-yieff1607972402.jpg The company … By Cointelegraph 2025-07-21
$3.4B in Ether lost forever due to user errors, Coinbase warns !3.4B in Ether lost forever due to user errors, Coinbase warnsimagesnews3-4b-in-ether-lost-forever-due-to-user-errors-coin4165f72b7427.jpg Ether lost … By Cointelegraph 2025-07-21
Ethereum mirrors stocks as ETH price chart hints at ‘final surge’ to $8K !Ethereum mirrors stocks as ETH price chart hints at final surge to 8Kimagesnewsethereum-mirrors-stocks-as-eth-price-chart-hints-a5ac95b878dfd.jpg … By Cointelegraph 2025-07-21
Blockchain compliance tools can slash TradFi costs: Chainlink co-founder !Blockchain compliance tools can slash TradFi costs Chainlink co-founderimagesnewsblockchain-compliance-tools-can-slash-tradfi-costs97367b626b3c.jpg … By Cointelegraph 2025-07-21
SEC explores Ethereum token standard for compliant securities !SEC explores Ethereum token standard for compliant securitiesimagesnewssec-explores-ethereum-token-standard-for-compliant70605b97834b.jpg ERC-3643 … By Cointelegraph 2025-07-21
Crypto funds post record $4.4B inflows as Ether ETPs break 2024 gains !Crypto funds post record 4.4B inflows as Ether ETPs break 2024 gainsimagesnewscrypto-funds-post-record-4-4b-inflows-as-ether-etpec6edcf5cb32.jpg … By Cointelegraph 2025-07-21
‘Altseason is here’ — 5 things to know in Bitcoin this week !Altseason is here 5 things to know in Bitcoin this weekimagesnewsaltseason-is-here-5-things-to-know-in-bitcoin-this322f6d020bcc.jpg Bitcoin price … By Cointelegraph 2025-07-21
Thailand SEC Moves to Tighten ICO Rules With Investor Testing Mandates The Thai SEC said the proposal aims to reduce burdens on ICO portals and investors while aligning oversight with industry standards. By Decrypt 2025-07-21
Ethereum’s Fusaka upgrade set for November, Glamsterdam planning next !Ethereums Fusaka upgrade set for November, Glamsterdam planning nextimagesnewsethereums-fusaka-upgrade-set-for-november-glamster04697ec9b539.jpg … By Cointelegraph 2025-07-21
US bank lobby challenges crypto firms’ bids for bank licences !US bank lobby challenges crypto firms bids for bank licencesimagesnewsus-bank-lobby-challenges-crypto-firms-bids-for-ban9b97cd0bc28c.jpg US banking … By Cointelegraph 2025-07-21
‘Rich Dad, Poor Dad’ author warns Bitcoin ‘bubble’ could burst soon !Rich Dad, Poor Dad author warns Bitcoin bubble could burst soonimagesnewsrich-dad-poor-dad-author-warns-bitcoin-bubble-coul050a198dd892.jpg Robert … By Cointelegraph 2025-07-21
What the GENIUS Act Means for XRP Investors The GENIUS Act benefits Ripples RLUSD stablecoin, but experts say its direct impact on XRP will be minimal. By Decrypt 2025-07-21
Blistering NFT ‘sweep’ underway as CryptoPunks, Penguins surge !Blistering NFT sweep underway as CryptoPunks, Penguins surgeimagesnewsblistering-nft-sweep-underway-as-cryptopunks-penguc3b55e5894dd.jpg CryptoSlam … By Cointelegraph 2025-07-21
These US States Have Passed Bitcoin Reserve Laws New Hampshire, Arizona, and Texas have all pushed to enable their treasuries to hold Bitcoin. Others are trying and failing. By Decrypt 2025-07-21
Crypto Pushes Deeper Into S&P 500 as Block Follows Coinbase Into Index The fintech firm will join the benchmark index on Wednesday, two months after crypto exchange Coinbase made its debut. By Decrypt 2025-07-21
Ethereum is scaling: TPS, gas limit up as validators back 45M target !Ethereum is scaling TPS, gas limit up as validators back 45M targetimagesnewsethereum-is-scaling-tps-gas-limit-up-as-validators80b84f5a26ad.jpg … By Cointelegraph 2025-07-21
UK working to sell $7B in seized Bitcoin to boost budget: Report !UK working to sell 7B in seized Bitcoin to boost budget Reportimagesnewsuk-working-to-sell-7b-in-seized-bitcoin-to-boost-bbff41016d437.jpg A new … By Cointelegraph 2025-07-21
Fix incoming for MetaMask bug that’s slowly killing solid-state drives !Fix incoming for MetaMask bug thats slowly killing solid-state drivesimagesnewsfix-incoming-for-metamask-bug-thats-slowly-killing2e962a8f8191.jpg … By Cointelegraph 2025-07-21
AI and blockchain are already disrupting legacy education system !AI and blockchain are already disrupting legacy education systemimagesnewsai-and-blockchain-are-already-disrupting-legacy-ed55779ce7169f.jpg … By Cointelegraph 2025-07-20
Netflix Uses Generative AI in TV Show for First Time The Eternaut is the first show from Netflix to use generative AI, which co-CEO Ted Sarandos called an incredible opportunity. By Decrypt 2025-07-20
Saylor signals Bitcoin buy as Strategy's stash climbs to over $71B !Saylor signals Bitcoin buy as Strategys stash climbs to over 71Bimagesnewssaylor-signals-bitcoin-buy-as-strategy-s-stash-cli41056fc9cc8e.jpg … By Cointelegraph 2025-07-20
Bitcoin gets $125K target as trader sees 'big move' next, ETH hits $3750 !Bitcoin gets 125K target as trader sees big move next, ETH hits 3750imagesnewsbitcoin-gets-125k-target-as-trader-sees-big-move-n002f13a386a5.jpg … By Cointelegraph 2025-07-20
Robots on the Jobsite: Why Construction Automation Is About Safety, Not Pink Slips Bedrock Robotics raised 80 million to retrofit bulldozers and excavators with AInot to cut jobs, but to solve a massive labor shortage and make … By Decrypt 2025-07-20
Embedding human rights into crypto isn’t optional, it’s foundational !Embedding human rights into crypto isnt optional, its foundationalimagesnewsembedding-human-rights-into-crypto-isnt-optional-i324b3e2f1432.jpg … By Cointelegraph 2025-07-20
High-leverage trader James Wynn opens 25x long on ETH, 10x on PEPE !High-leverage trader James Wynn opens 25x long on ETH, 10x on PEPEimagesnewshigh-leverage-trader-james-wynn-opens-25x-long-on-b10bb8f94870.jpg James … By Cointelegraph 2025-07-20
Professor Coin: Can Bitcoin Replace Gold? Bitcoin has often been touted as a modern, decentralized alternative to precious metalswe look at the latest academic evidence. By Decrypt 2025-07-20
Experts say ‘just a starting point’ as Crypto Week ends on a high note !Experts say just a starting point as Crypto Week ends on a high noteimagesnewsexperts-say-just-a-starting-point-as-crypto-week-ee17c1fd575b5.jpg The … By Cointelegraph 2025-07-20
GENIUS Act blocks Big Tech, banks from dominating stablecoins: Circle exec !GENIUS Act blocks Big Tech, banks from dominating stablecoins Circle … By Cointelegraph 2025-07-20
Charles Hoskinson says audit report ‘shaping up’ for August release !Charles Hoskinson says audit report shaping up for August releaseimagesnewscharles-hoskinson-says-audit-report-shaping-up-for213671ab19bc.jpg … By Cointelegraph 2025-07-20
Bitcoin 43% social chat dominance suggests 'key entry point' ahead !Bitcoin 43 social chat dominance suggests key entry point aheadimagesnewsbitcoin-43-social-chat-dominance-suggests-key-entraa36792fbd27.jpg … By Cointelegraph 2025-07-20
XLM's price to rocket like XRP, Trump’s big crypto nod: Hodler’s Digest, July 13 – 19 !XLMs price to rocket like XRP, Trumps big crypto nod Hodlers Digest, July 13 … By Cointelegraph 2025-07-19
US Lawmaker sounds alarm on GENIUS bill, says it's a CBDC Trojan Horse !US Lawmaker sounds alarm on GENIUS bill, says its a CBDC Trojan Horseimagesnewsus-lawmaker-sounds-alarm-on-genius-bill-says-it-s-68a7ad91727e.jpg … By Cointelegraph 2025-07-19
Bitcoin Minimum Fee Rate Slashed by 90%—Is That a Good Thing? The fee rate to get a Bitcoin transaction processed just got cut substantially as miners struggle to fill blockspace. By Decrypt 2025-07-19
Macro drivers will dampen Bitcoin’s halving cycle — Tim Draper !Macro drivers will dampen Bitcoins halving cycle Tim Draperimagesnewsmacro-drivers-will-dampen-bitcoins-halving-cycle-t033a8c456537.jpg The decline … By Cointelegraph 2025-07-19
California Sheriffs Believe 74-Year-Old's Disappearance Linked to Son's Crypto Fortune A mans disappearance in California is being investigated as a possible crypto-related kidnapping, following a spate of wrench attacks. By Decrypt 2025-07-19
Indian crypto exchange CoinDCX hacked, $44 million drained !Indian crypto exchange CoinDCX hacked, 44 million drainedimagesnewsindian-crypto-exchange-coindcx-hacked-44-million-debfedb73f55b.jpg The … By Cointelegraph 2025-07-19
Ethereum Treasury SharpLink Shares Plunge 20% Amid $6 Billion Plan to Buy More ETH The company is one of several Ethereum treasuries to add sizable amounts to their holdings over the past two weeks. By Decrypt 2025-07-19
Crypto rules for mortgages must reflect self-custody reality !Crypto rules for mortgages must reflect self-custody realityimagesnewscrypto-rules-for-mortgages-must-reflect-self-custo93962a5b2b34.jpg The FHFA … By Cointelegraph 2025-07-19
Can XRP price reach $20? These charts say ‘full bull’ phase is still ahead !Can XRP price reach 20? These charts say full bull phase is still aheadimagesnewscan-xrp-price-reach-20-these-charts-say-full-bull-dbb053165dee.jpg … By Cointelegraph 2025-07-19
Bitcoin Price Poised to Rally to $150K by October, Says Cooper Research Bitcoin could trade as high as 150,000 by October if inflows to spot Bitcoin ETFs remain strong this summer, Cooper Research projects. By Decrypt 2025-07-19
Spot Bitcoin ETFs gains $363M, extend 12-day inflow streak to $6.6B !Spot Bitcoin ETFs gains 363M, extend 12-day inflow streak to 6.6Bimagesnewsspot-bitcoin-etfs-gains-363m-extend-12-day-inflow-b88e24ca00e1.jpg Spot … By Cointelegraph 2025-07-19
‘Crypto Week’ ushers in big change: What happens now? !Crypto Week ushers in big change What happens now?imagesnewscrypto-week-ushers-in-big-change-what-happens-now9449cf47c672.jpg Crypto Week in the US … By Cointelegraph 2025-07-19
They trusted a sealed wallet from TikTok, and it cost them $6.9M !They trusted a sealed wallet from TikTok, and it cost them 6.9Mimagesnewsthey-trusted-a-sealed-wallet-from-tiktok-and-it-coc5842fc77da9.jpg A fake … By Cointelegraph 2025-07-19
Ether preps record short squeeze as analysis sees $4K ETH price 'soon' !Ether preps record short squeeze as analysis sees 4K ETH price soonimagesnewsether-preps-record-short-squeeze-as-analysis-sees-c43d28bf4a01.jpg … By Cointelegraph 2025-07-19
Charles Schwab plans to launch Bitcoin, Ether spot trading, CEO says !Charles Schwab plans to launch Bitcoin, Ether spot trading, CEO saysimagesnewscharles-schwab-plans-to-launch-bitcoin-ether-spot-e2e8ec252840.jpg … By Cointelegraph 2025-07-19
Crypto exchange Bullish files for US IPO, targets NYSE listing as “BLSH” !Crypto exchange Bullish files for US IPO, targets NYSE listing as BLSHimagesnewscrypto-exchange-bullish-files-for-us-ipo-targets-n1bf5ce9fb295.jpg … By Cointelegraph 2025-07-19
Jack Dorsey’s Block to join S&P 500, stock surges 9% after-hours !Jack Dorseys Block to join SP 500, stock surges 9 after-hoursimagesnewsjack-dorseys-block-to-join-s-p-500-stock-surges-9-d3d51da7e7fa.jpg Blocks … By Cointelegraph 2025-07-19
Bitcoin ‘pausing here for air’ likely, but another July ATH still possible !Bitcoin pausing here for air likely, but another July ATH still possibleimagesnewsbitcoin-pausing-here-for-air-likely-but-another-ju4dfb61b41933.jpg … By Cointelegraph 2025-07-19
Bitcoin’s first Batman? Peter McCormack plans to buy his own police force !Bitcoins first Batman? Peter McCormack plans to buy his own police forceimagesnewsbitcoins-first-batman-peter-mccormack-plans-to-buyf8d4c6e3d47c.jpg … By Cointelegraph 2025-07-19
Hacker reconnaissance work continues on TeleMessage app vulnerability — Report !Hacker reconnaissance work continues on TeleMessage app vulnerability … By Cointelegraph 2025-07-18
Tether's CEO Says USDT Is Coming to America—And Circle’s CEO Isn’t Afraid Leaders of the worlds top two stablecoin companies laid out their plans for the future after President Trump signed sweeping stablecoin legislation … By Decrypt 2025-07-18
The rise of ETFs challenges Bitcoin’s self-custody roots !The rise of ETFs challenges Bitcoins self-custody rootsimagesnewsthe-rise-of-etfs-challenges-bitcoins-self-custody-58c0b816db29.jpg The growing … By Cointelegraph 2025-07-18
GENIUS' ban on stablecoin yield will drive demand for Ethereum DeFi — Analysts !GENIUS ban on stablecoin yield will drive demand for Ethereum DeFi … By Cointelegraph 2025-07-18
Public Keys: Coinbase and MSTR Break Records, and Who's Holding Strategy's Bitcoin Billions? Strategys 70 billion Bitcoin custodian list remains secret as it and Coinbase set records, all while new crypto treasuries take root. By Decrypt 2025-07-18
XRP Leaves Dogecoin Chasing Its Tail, Ethereum in the Ether: Analysis The price of XRP has hit a new all-time high after seven years. Can Ethereum and Dogecoin catch up? Heres what the charts say. By Decrypt 2025-07-18
Lawsuits piling up against Strategy could take years, go nowhere, lawyer says !Lawsuits piling up against Strategy could take years, go nowhere, lawyer … By Cointelegraph 2025-07-18
Bitcoin Dominance Sinks as Ethereum, XRP Rise The original digital asset accounted for 61 of the cryptocurrency markets value on Friday, falling from 65.5 last week. By Decrypt 2025-07-18
Bitcoin’s lower support retests shift traders’ focus to XLM, LTC, ETC, BNB !Bitcoins lower support retests shift traders focus to XLM, LTC, ETC, BNBimagesnewsbitcoins-lower-support-retests-shift-traders-focus2f902ee8a5be.jpg … By Cointelegraph 2025-07-18
Crypto Biz: Wall Street giants bet on stablecoins !Crypto Biz Wall Street giants bet on stablecoinsimagesnewscrypto-biz-wall-street-giants-bet-on-stablecoins3fe53fef7d3d.jpg JPMorgan, Citigroup and … By Cointelegraph 2025-07-18
Crypto execs center stage as Trump signs stablecoin bill into law !Crypto execs center stage as Trump signs stablecoin bill into lawimagesnewscrypto-execs-center-stage-as-trump-signs-stablecoia94eb3ab3e30.jpg … By Cointelegraph 2025-07-18
Trump Signs GENIUS Act Into Law, Ushering In Crypto’s Integration With US Economy President Trump signed the stablecoin bill at a flashy ceremony attended by industry leaders, just a day after the legislation was passed by Congress. By Decrypt 2025-07-18
Senate to consider Trump's CFTC pick as crypto oversight hangs in the balance !Senate to consider Trumps CFTC pick as crypto oversight hangs in the … By Cointelegraph 2025-07-18
Bitcoin’s rise with Wall Street comes at a potential philosophical cost !Bitcoins rise with Wall Street comes at a potential philosophical costimagesnewsbitcoins-rise-with-wall-street-comes-at-a-potentia987d95125de5.jpg … By Cointelegraph 2025-07-18
Schwab Wants to Offer Stablecoin Amid Expanding Crypto Services Push: CEO Charles Schwabs CEO said that the U.S.-based brokerage is considering offering a dollar-pegged token as the stablecoin market is poised to grow. By Decrypt 2025-07-18
El Salvador hasn’t bought Bitcoin since signing loan deal, IMF says !El Salvador hasnt bought Bitcoin since signing loan deal, IMF saysimagesnewsel-salvador-hasnt-bought-bitcoin-since-signing-loadb3987ba14b1.jpg The … By Cointelegraph 2025-07-18
How to use Google Gemini to turn crypto news into trade signals !How to use Google Gemini to turn crypto news into trade signalsimagesnewshow-to-use-google-gemini-to-turn-crypto-news-into-65c94f39969f.jpg Google … By Cointelegraph 2025-07-18
Bitcoin becomes 5th global asset ahead of “Crypto Week,” flips Amazon: Finance Redefined !Bitcoin becomes 5th global asset ahead of Crypto Week, flips Amazon Finance … By Cointelegraph 2025-07-18
XLM could follow XRP’s monster rally and hit $1 soon: Fact or fiction? !XLM could follow XRPs monster rally and hit 1 soon Fact or fiction?imagesnewsxlm-could-follow-xrps-monster-rally-and-hit-1-soonb6f34da4cf16.jpg XLM … By Cointelegraph 2025-07-18
Ethereum Is Pumping, But Solana Will Still Outperform: 21Shares Solana is becoming a blue-chip altcoin, and no amount of momentum for Ethereum can change that, according to 21Shares research head Adrian Fritz. By Decrypt 2025-07-18
Crypto execs to attend US stablecoin bill signing after Thursday vote !Crypto execs to attend US stablecoin bill signing after Thursday voteimagesnewscrypto-execs-to-attend-us-stablecoin-bill-signing-209567030e57.jpg … By Cointelegraph 2025-07-18
$5 trillion altcoin season pending as TOTAL2 market cap hits $1.5T !5 trillion altcoin season pending as TOTAL2 market cap hits 1.5Timagesnews5-trillion-altcoin-season-pending-as-total2-marketca6646bf3a3a.jpg Capital … By Cointelegraph 2025-07-18
Coinbase Doesn't Custody All of Strategy's Bitcoin—So Who Does? Strategys 72B Bitcoin stash is spread across multiple secret custodians, with only Coinbase confirmed and Fidelity potentially holding 70,000 BTC. By Decrypt 2025-07-18
Metaplanet vs. Semler Scientific: The race to become Bitcoin’s biggest corporate whale !Metaplanet vs. Semler Scientific The race to become Bitcoins biggest corporate … By Cointelegraph 2025-07-18
'I Want to Cry': Dave Portnoy Says He Fumbled an XRP Bag Worth Millions The Barstool Sports founder shared his XRP misplay amid this weeks record surge, years after admitting that he fucked up Bitcoin. By Decrypt 2025-07-18
CRYPTO MARKET CAP TOPS $4T, XRP HITS ATH, ETH TREASURIES HEAT-UP XRP hits ATH, ETH nears 4k. BlackRock files to add staking to ETH ETF. Crypto market cap hits 4T for the first time. Trump to sign EO allowing crypto … By Decrypt 2025-07-18
US SEC Chair Atkins: Education is key for crypto in retirement accounts !US SEC Chair Atkins Education is key for crypto in retirement accountsimagesnewsus-sec-chair-atkins-education-is-key-for-crypto-in444b236cfff9.jpg … By Cointelegraph 2025-07-18
Labour Call to Ban Crypto Political Donations an ‘Attack’, Says Crypto UK Nigel Farages Reform UK party started accepting crypto donations last month, now a Labour MP is arguing it should be banned. By Decrypt 2025-07-18
CZ is right: There is a structural gap in Web3 trading !CZ is right There is a structural gap in Web3 tradingimagesnewscz-is-right-there-is-a-structural-gap-in-web3-tradc701fc5f3a1e.jpg Web3s current … By Cointelegraph 2025-07-18
How Jack Dorsey’s new app lets you chat without the internet and why it matters !How Jack Dorseys new app lets you chat without the internet and why it … By Cointelegraph 2025-07-18
Can ADA price reach $3? Cardano greenlit for 216% rally !Can ADA price reach 3? Cardano greenlit for 216 rallyimagesnewscan-ada-price-reach-3-cardano-greenlit-for-216-ralba32bd1dbcd1.jpg ADA price catches … By Cointelegraph 2025-07-18
SEC Chair Atkins considers innovation exemption to boost tokenization !SEC Chair Atkins considers innovation exemption to boost tokenizationimagesnewssec-chair-atkins-considers-innovation-exemption-toadc86583396b.jpg … By Cointelegraph 2025-07-18
Bitcoin whale’s $9.6B transfer, GENIUS Act spark correction concerns !Bitcoin whales 9.6B transfer, GENIUS Act spark correction concernsimagesnewsbitcoin-whales-9-6b-transfer-genius-act-spark-corr0bec319e4db7.jpg An OG … By Cointelegraph 2025-07-18
Stellar’s XLM has 'most bullish chart' in crypto, mirroring XRP price !Stellars XLM has most bullish chart in crypto, mirroring XRP priceimagesnewsstellars-xlm-has-most-bullish-chart-in-crypto-mirre0487dee3126.jpg … By Cointelegraph 2025-07-18
Franchise-led SOL treasury expansion launches with Kraken, Pantera support !Franchise-led SOL treasury expansion launches with Kraken, Pantera … By Cointelegraph 2025-07-18
UK elections: How crypto donation risks are dividing MPs !UK elections How crypto donation risks are dividing MPsimagesnewsuk-elections-how-crypto-donation-risks-are-dividine52743c07f9f.jpg UK lawmakers are … By Cointelegraph 2025-07-18
What Is Pump.fun? The Solana Meme Coin Factory Pump.fun allows anyone to create Solana tokens in a minute for completely free, spawning some of the biggest memes of 2024. By Decrypt 2025-07-18
NCA Officer Who Stole Bitcoin From Crime Network Jailed for Five and a Half Years Paul Chowles theft was nearly written off until a search back in 2022 uncovered private keys linking him to the stolen funds. By Decrypt 2025-07-18
Why FTX ruling on China payouts matters: Global precedent at stake !Why FTX ruling on China payouts matters Global precedent at stakeimagesnewswhy-ftx-ruling-on-china-payouts-matters-global-pre7b1f54120fe8.jpg A US … By Cointelegraph 2025-07-18
‘Early Signals’ of Altcoin Season as OG Tokens Pump Following XRP, BTC All-time Highs XRP set an all-time high on Thursday as old-school cryptocurrencies Ethereum Classic, Litecoin, and Bitcoin Cash also saw notable gains. By Decrypt 2025-07-18
'Short-Term Contraction' Expected as Hungary Adds Crypto Trading to Criminal Code Hungarys newly updated laws on cryptocurrency trading could have a negative impact on the domestic crypto market, according to the Blockchain Hungary … By Decrypt 2025-07-18
Former rugby player sentenced for $900K crypto mining Ponzi !Former rugby player sentenced for 900K crypto mining Ponziimagesnewsformer-rugby-player-sentenced-for-900k-crypto-mini617d93163580.jpg Former rugby … By Cointelegraph 2025-07-18
Indian crypto users may ‘force’ policy shift amid mounting demand !Indian crypto users may force policy shift amid mounting demandimagesnewsindian-crypto-users-may-force-policy-shift-amid-mo87caa46806b6.jpg Crypto … By Cointelegraph 2025-07-18
Crypto Market Cap Tops $4 Trillion as Bitcoin, Ethereum Drive Institutional Inflows The crypto rally showed no sign of fading after the U.S. House vote, suggesting short-term momentum will be sustained, experts told Decrypt. By Decrypt 2025-07-18
XRP jumps 22% into price discovery as market cap hits a record $210B !XRP jumps 22 into price discovery as market cap hits a record 210Bimagesnewsxrp-jumps-22-into-price-discovery-as-market-cap-hi0daf23a86fe1.jpg XRPs … By Cointelegraph 2025-07-18
Fintech firms will move to DeFi lending within 3 years: Morpho co-founder !Fintech firms will move to DeFi lending within 3 years Morpho co-founderimagesnewsfintech-firms-will-move-to-defi-lending-within-3-y6e1238efb640.jpg … By Cointelegraph 2025-07-18
Bitcoin golden cross that sparked 2,000% BTC gains is already here !Bitcoin golden cross that sparked 2,000 BTC gains is already hereimagesnewsbitcoin-golden-cross-that-sparked-2000-btc-gains-i2ad1b2589da1.jpg … By Cointelegraph 2025-07-18
Memecoin $79B rally means capital has nowhere better to go: Exec !Memecoin 79B rally means capital has nowhere better to go Execimagesnewsmemecoin-79b-rally-means-capital-has-nowhere-bettec2f80fabfffe.jpg Neiro … By Cointelegraph 2025-07-18
Bitcoin Back Above $120K as Clear Crypto Policy ‘Invites’ Capital, Institutions Bitcoin has slowed following a profit-taking dip, but investor conviction is rising as U.S. lawmakers advance new crypto legislation. By Decrypt 2025-07-18
Sharplink Gaming’s expanded $6B share offering could buy 1% of ETH !Sharplink Gamings expanded 6B share offering could buy 1 of ETHimagesnewssharplink-gamings-expanded-6b-share-offering-couldd0d723115bb1.jpg The … By Cointelegraph 2025-07-18
Dave Portnoy dumped his XRP two weeks ago: ‘I want to cry’ !Dave Portnoy dumped his XRP two weeks ago I want to cryimagesnewsdave-portnoy-dumped-his-xrp-two-weeks-ago-i-want-tc843cd0b1785.jpg Barstool Sports … By Cointelegraph 2025-07-18
Satoshi-era Bitcoin whale shifts second 40K BTC pile to Galaxy Digital !Satoshi-era Bitcoin whale shifts second 40K BTC pile to Galaxy Digitalimagesnewssatoshi-era-bitcoin-whale-shifts-second-40k-btc-pib6957d8288e0.jpg … By Cointelegraph 2025-07-18
GENIUS Act heads to Trump’s desk: Here’s what will change !GENIUS Act heads to Trumps desk Heres what will changeimagesnewsgenius-act-heads-to-trumps-desk-heres-what-will-ch465f5eaa04c0.jpg The … By Cointelegraph 2025-07-18
Ex-Rugby Player Sentenced For $900K Crypto Mining Ponzi Scheme Shane Moore targeted fellow rugby players with promises of 1 daily returns, then spent their money on luxury apartments and designer goods. By Decrypt 2025-07-18
‘Blood Rushing Back’ Into Crypto as XRP, Dogecoin Soar A wave of U.S. crypto policies and an influx of institutional capital are driving up crypto prices, including those of XRP and Dogecoin. By Decrypt 2025-07-18
Crypto market cap nears $4T, just behind the biggest company in the world !Crypto market cap nears 4T, just behind the biggest company in the worldimagesnewscrypto-market-cap-nears-4t-just-behind-the-biggest431817418bfa.jpg … By Cointelegraph 2025-07-18
Kraken Opens US Futures Trading as Congress Advances Landmark Crypto Bills Krakens development lands as Congress advances the GENIUS and CLARITY Acts, signaling a turning point in U.S. crypto policy. By Decrypt 2025-07-18
BTC Digital ditches Bitcoin for Ethereum in ‘transformative’ shift !BTC Digital ditches Bitcoin for Ethereum in transformative shiftimagesnewsbtc-digital-ditches-bitcoin-for-ethereum-in-transfaaa2ee84101d.jpg The … By Cointelegraph 2025-07-18
Ether rockets 47% in a month as hedge fund says ‘rapid reversal’ unlikely !Ether rockets 47 in a month as hedge fund says rapid reversal unlikelyimagesnewsether-rockets-47-in-a-month-as-hedge-fund-says-rapa9c0d94259c8.jpg … By Cointelegraph 2025-07-18
Trump eyes executive order to open up retirement funds to crypto: FT !Trump eyes executive order to open up retirement funds to crypto FTimagesnewstrump-eyes-executive-order-to-open-up-retirement-ffccd5e56e58a.jpg … By Cointelegraph 2025-07-18
Trump’s court pick would bring crypto baggage to the bench !Trumps court pick would bring crypto baggage to the benchimagesnewstrumps-court-pick-would-bring-crypto-baggage-to-thc55d7d5b4e1d.jpg The presidents … By Cointelegraph 2025-07-17
E-Bike Maker’s Shares Soar 135% on $500 Million Bitcoin Treasury Plan Electric vehicle maker Volcon announced that it would purchase about 470 million in Bitcoin, adding to the list of corporate BTC treasuries. By Decrypt 2025-07-17
US to investigate Brazil’s digital payment system !US to investigate Brazils digital payment systemimagesnewsus-to-investigate-brazils-digital-payment-system1d1560c54573.jpg As Brazils Pix system … By Cointelegraph 2025-07-17
300% DOGE price rally expected if this key price level is reclaimed !300 DOGE price rally expected if this key price level is reclaimedimagesnews300-doge-price-rally-expected-if-this-key-price-lec9818f6ebd20.jpg DOGE … By Cointelegraph 2025-07-17
XRP and Ethereum Are Pumping: Is Solana Next? Here’s What the Charts Say XRP soared to new all-time highs today, with Ethereum showing impressive weekly gains. Technical indicators suggest Solana may not be far behind. By Decrypt 2025-07-17
Canary Capital bets on Injective with staked ETF filing !Canary Capital bets on Injective with staked ETF filingimagesnewscanary-capital-bets-on-injective-with-staked-etf-f715474a63f08.jpg The move follows … By Cointelegraph 2025-07-17
Ethereum ETFs Set Daily Record With $726 Million in Investments as ETH Soars The nine spot Ethereum ETFs generated more than 726 million in investments on Wednesday as ETHs price rose to its highest level in months. By Decrypt 2025-07-17
US prosecutors expect to close case against Roman Storm by July 25 !US prosecutors expect to close case against Roman Storm by July 25imagesnewsus-prosecutors-expect-to-close-case-against-roman-181306a7b0ab.jpg The … By Cointelegraph 2025-07-17
Wall Street piles into Ethereum as stablecoins are greenlit and RWAs expand !Wall Street piles into Ethereum as stablecoins are greenlit and RWAs … By Cointelegraph 2025-07-17
XRP Price Hits New All-Time High After Seven Long Years The price of XRP rose to a record high, soaring past a seven-year-old milestone amid broader momentum for altcoins in the crypto market. By Decrypt 2025-07-17
Nasdaq files application to add staking for BlackRock iShares ETH ETF !Nasdaq files application to add staking for BlackRock iShares ETH ETFimagesnewsnasdaq-files-application-to-add-staking-for-blackra92396cfe6f0.jpg … By Cointelegraph 2025-07-17
OpenAI's ChatGPT Agent Launches With Expanded Powers—And Elevated Risk OpenAIs new ChatGPT Agent can do complex tasks on behalf of users, but it comes with potentially greater risks. By Decrypt 2025-07-17
BlackRock Files With SEC to Include Staking in Ethereum ETF BlackRock aims to include staking in its spot Ethereum ETF, according to a rules change request filed to the SEC. By Decrypt 2025-07-17
Bitcoin-backed mortgages debut in Australia amid housing crisis !Bitcoin-backed mortgages debut in Australia amid housing crisisimagesnewsbitcoin-backed-mortgages-debut-in-australia-amid-hd6fb91378366.jpg … By Cointelegraph 2025-07-17
Bitcoin Mining Firm Stock Spikes After $500 Million Raise for Dogecoin Treasury Bitcoin mining firm Bit Origin is tapping Dogecoin for its crypto treasury, with its stock soaring after the move was revealed. By Decrypt 2025-07-17
SUI’s next ‘altcoin season’ stop could be $5: Here’s why !SUIs next altcoin season stop could be 5 Heres whyimagesnewssuis-next-altcoin-season-stop-could-be-5-heres-why3069b90feb17.jpg The start of a new … By Cointelegraph 2025-07-17
'Historic': Trump to Sign Nation’s First Major Crypto Bill After Passing House The stablecoin-focused GENIUS Act passed the House with strong bipartisan support. A market structure bill also passed, and will now head to the … By Decrypt 2025-07-17
Semler Scientific adds $25M in Bitcoin, but stock slides 22% YTD !Semler Scientific adds 25M in Bitcoin, but stock slides 22 YTDimagesnewssemler-scientific-adds-25m-in-bitcoin-but-stock-sl20cbd7f8f810.jpg The … By Cointelegraph 2025-07-17
US House passes market structure bill as crypto week continues !US House passes market structure bill as crypto week continuesimagesnewsus-house-passes-market-structure-bill-as-crypto-weead227bb212b.jpg The first … By Cointelegraph 2025-07-17
Bitcoin smack dab in the middle of its adoption curve: Fidelity analyst !Bitcoin smack dab in the middle of its adoption curve Fidelity analystimagesnewsbitcoin-smack-dab-in-the-middle-of-its-adoption-cudbe2b9bbc326.jpg … By Cointelegraph 2025-07-17
Ripple Founder Chris Larsen Moves Millions More XRP to Coinbase With All-Time High in Sight Did he sell? Ripple co-founder and Executive Chairman Chris Larsen has moved millions of dollars worth of XRP to Coinbase. By Decrypt 2025-07-17
Bitcoin resistance at $120K hints at consolidation before impulse rally to $135K !Bitcoin resistance at 120K hints at consolidation before impulse rally to … By Cointelegraph 2025-07-17
Myriad Moves: Will XRP and Ethereum Hit All-Time Highs? And Wen PUMP Airdrop? Top markets on Myriad this week center on record price marks for Ethereum and XRP, along with the Pump.fun PUMP token airdrop. By Decrypt 2025-07-17
AI Companies Want to Read Your Chatbot's Thoughts—And That Might Include Yours A new paper from 40 AI safety researchers proposes monitoring the thoughts of AI models before they act. Experts warn this safety tool could become a … By Decrypt 2025-07-17
Former Pump.fun Employee Sits in Prison as Solana Launchpad Breaks $770M in Revenue Jarett Dunn, once an employee of Pump.fun, faces at least seven years in prison as he awaits a hearing in the U.K. from behind bars. By Decrypt 2025-07-17
XRP cloud mining in 2025: How much can you really earn? !XRP cloud mining in 2025 How much can you really earn?imagesnewsxrp-cloud-mining-in-2025-how-much-can-you-really-e60a3c90e6135.jpg XRP cloud mining … By Cointelegraph 2025-07-17
Peter Thiel-Backed BitMine Gobbles Up More Ethereum, Hits $1B in ETH Holdings The NYSE-listed firm now holds more than 300,000 ETH. By Decrypt 2025-07-17
Crypto Week Day 4: US lawmakers remain divided on key bills !Crypto Week Day 4 US lawmakers remain divided on key billsimagesnewscrypto-week-day-4-us-lawmakers-remain-divided-on-k3163fe3e887d.jpg Republicans … By Cointelegraph 2025-07-17
Canary Files for Staked Injective ETF as Interest in Altcoin Funds Grows The asset manager filed Thursday with the SEC to debut its Staked INJ ETF, which would allow investors to earn yield on its funds underlying tokens. By Decrypt 2025-07-17
Bitcoin Creator Satoshi Nakamoto Is Now Richer Than Bill Gates—And Closing In on Buffett Satoshi Nakamoto is richer than Microsoft co-founder Bill Gates and Dell founder Michael Delland Bitcoin critic Warren Buffett is next. By Decrypt 2025-07-17
ETH SURGES ON INFLOWS, HOUSE ADVANCES CRYPTO BILLS, BASE REVAMP ETH nears 3,500 on huge ETF inflows. Sharplink stock hits 35, completes ATM program. US House advances crypto bills. Coinbase renames wallet Base, … By Decrypt 2025-07-17
Cantor, Adam Back Team Up to Launch Bitcoin Treasury Firm With $3.5 Billion in BTC After launching Twenty One XXI, Cantor Fitzgerald is making another big Bitcoin treasury move with early Bitcoiner Adam Back. By Decrypt 2025-07-17
LINK news update: Pro crypto convergence in TradFi and DeFi may start rally to $18 !LINK news update Pro crypto convergence in TradFi and DeFi may start rally to … By Cointelegraph 2025-07-17
Bhutan should embrace decentralized identity systems !Bhutan should embrace decentralized identity systemsimagesnewsbhutan-should-embrace-decentralized-identity-systec21597e28293.jpg Bhutans unique … By Cointelegraph 2025-07-17
Epstein, Antichrists & Dragons: Crypto Week in Congress Nearly Goes Off the Rails What does Crypto Week in Congress, and the drama that ensued Wednesday, have to do with the Jeffrey Epstein scandal? More than you might think, … By Decrypt 2025-07-17
Japan just found a way to let you earn XRP without spending yen !Japan just found a way to let you earn XRP without spending yenimagesnewsjapan-just-found-a-way-to-let-you-earn-xrp-without93ed92bb049e.jpg Aplus … By Cointelegraph 2025-07-17
XRP, Dogecoin Lead Altcoin Gains as Bitcoin Remains Flat Over 70 of the top 100 cryptocurrencies are in the green since this time yesterdayand notably, Bitcoin isnt one of them. By Decrypt 2025-07-17
Ethereum looks to break $3,500 as RSI 'buy signal' targets $10K ETH price !Ethereum looks to break 3,500 as RSI buy signal targets 10K ETH priceimagesnewsethereum-looks-to-break-3500-as-rsi-buy-signal-tarfbda6cb1c620.jpg … By Cointelegraph 2025-07-17
USDt market cap hits $160B, cementing its ‘digital dollar’ role: Tether CEO !USDt market cap hits 160B, cementing its digital dollar role Tether CEOimagesnewsusdt-market-cap-hits-160b-cementing-its-digital-doefce8b815711.jpg … By Cointelegraph 2025-07-17
Man Attempts Tattoo World Record By Inking ‘Pump.fun’ on Himself 700 Times Pump.fun has become a hotbed for world record attempts, with the latest dev gunning to tattoo the Solana launchpads name 700 times. By Decrypt 2025-07-17
RGB Protocol to bring tokenized assets, USDT to Bitcoin !RGB Protocol to bring tokenized assets, USDT to Bitcoinimagesnewsrgb-protocol-to-bring-tokenized-assets-usdt-to-bita274a2ebd4df.jpg Boosty Labs … By Cointelegraph 2025-07-17
BTCFi TVL jumps 22x to $7B, but trust remains an issue !BTCFi TVL jumps 22x to 7B, but trust remains an issueimagesnewsbtcfi-tvl-jumps-22x-to-7b-but-trust-remains-an-issa0072f0ad0c7.jpg BTCFi TVL soared … By Cointelegraph 2025-07-17
DEX-to-CEX ratio hits new high as crypto traders flee centralization !DEX-to-CEX ratio hits new high as crypto traders flee centralizationimagesnewsdex-to-cex-ratio-hits-new-high-as-crypto-traders-fec132e12afe0.jpg … By Cointelegraph 2025-07-17
Bitcoin’s next chapter: From passive asset to financial powerhouse !Bitcoins next chapter From passive asset to financial powerhouseimagesnewsbitcoins-next-chapter-from-passive-asset-to-financ3ceb94e9aed9.jpg This … By Cointelegraph 2025-07-17
SEC delays in-kind redemption decision for Bitwise crypto ETFs !SEC delays in-kind redemption decision for Bitwise crypto ETFsimagesnewssec-delays-in-kind-redemption-decision-for-bitwise5dbcd6da38db.jpg The US … By Cointelegraph 2025-07-17
Asia Emerges as Major Hotspot for Violent Crypto Crime: Chainalysis The region is emerging as a focal point in the global surge of crypto-related theft and laundering, according to a new report. By Decrypt 2025-07-17
Bitcoin ’wrench attacks’ on track to double its worst year !Bitcoin wrench attacks on track to double its worst yearimagesnewsbitcoin-wrench-attacks-on-track-to-double-its-wors26e9bb40fdd6.jpg There have … By Cointelegraph 2025-07-17
60% of PUMP presale participants sold or transferred to CEXs !60 of PUMP presale participants sold or transferred to CEXsimagesnews60-of-pump-presale-participants-sold-or-transferre40224169acbf.jpg BitMEX said … By Cointelegraph 2025-07-17
XRP is about to hit $200B market cap for first time; price nears record !XRP is about to hit 200B market cap for first time price nears recordimagesnewsxrp-is-about-to-hit-200b-market-cap-for-first-time6285341e74cf.jpg … By Cointelegraph 2025-07-17
Australian Regulator Flags Crypto as Top Threat in Financial Crime Crackdown Crypto firms must prepare for stricter rules by 2026 as AUSTRAC targets sector-wide financial crime vulnerabilities. By Decrypt 2025-07-17
Is FOMO back? Bitcoin first timers buy 140K BTC in 2 weeks !Is FOMO back? Bitcoin first timers buy 140K BTC in 2 weeksimagesnewsis-fomo-back-bitcoin-first-timers-buy-140k-btc-in-cd5fad4cea6b.jpg Bitcoin … By Cointelegraph 2025-07-17
36% of Gen Z spend crypto daily; Gen X leads high-value spending !36 of Gen Z spend crypto daily Gen X leads high-value spendingimagesnews36-of-gen-z-spend-crypto-daily-gen-x-leads-high-va755abf1c3946.jpg Gaming, … By Cointelegraph 2025-07-17
ETH + DOGE LEAD CRYPTO, PENGU UP BIG, ETH ETF INFLOWS CATCHING BTC ETH, DOGE lead crypto majors higher. ETH ETF inflows now 50-90 BTC inflows. BTC inflows to exchanges hit 9.4bn after CPI. House fails to advance … By Decrypt 2025-07-17
3 charts scream ‘It’s altcoin season’ as Bitcoin dominance hits 8-week lows !3 charts scream Its altcoin season as Bitcoin dominance hits 8-week lowsimagesnews3-charts-scream-its-altcoin-season-as-bitcoin-domi0d31303dc646.jpg … By Cointelegraph 2025-07-17
CRYPTO BILLS STUCK, ETH LEADS MAJORS, PUMP STARTS BUYBACKS ETH, DOGE lead crypto majors higher. ETH ETF inflows now 50-90 BTC inflows. BTC inflows to exchanges hit 9.4bn after CPI. House fails to advance … By Decrypt 2025-07-17
Memecoin market cap grows 29% in July !Memecoin market cap grows 29 in Julyimagesnewsmemecoin-market-cap-grows-29-in-julyc6adae05d75f.jpg Memecoin market cap hits 72B in July, driven by … By Cointelegraph 2025-07-17
Pakistan’s crypto minister, El Salvador’s president discuss Bitcoin strategy !Pakistans crypto minister, El Salvadors president discuss Bitcoin … By Cointelegraph 2025-07-17
What is a seed phrase, and why is it important? !What is a seed phrase, and why is it important?imagesnewswhat-is-a-seed-phrase-and-why-is-it-important3494ae19677d.jpg Its crucial to securely back … By Cointelegraph 2025-07-17
Can Ethereum Breach New All-Time Highs This Year? Ethereum fundamentals and positioning are drawing renewed interest from institutions, lifting price and sentiment as analysts eye a new high. By Decrypt 2025-07-17
Michael Saylor’s Strategy hits record market cap amid Bitcoin surge !Michael Saylors Strategy hits record market cap amid Bitcoin surgeimagesnewsmichael-saylors-strategy-hits-record-market-cap-am13252ba7affd.jpg … By Cointelegraph 2025-07-17
UK officer jailed for 50 Bitcoin theft during Silk Road 2.0 probe !UK officer jailed for 50 Bitcoin theft during Silk Road 2.0 probeimagesnewsuk-officer-jailed-for-50-bitcoin-theft-during-silk9c6ae543b566.jpg The UK … By Cointelegraph 2025-07-17
Coinbase Unveils Its ‘Everything App,’ Merging Wallet, Social, and AI Tools Coinbases Base app, described as game-changing, combines cryptocurrency, AI, and social media into a single, all-in-one platform. By Decrypt 2025-07-17
House Clears Key Crypto Bills for Final Vote After Record 9-Hour Standoff A nearly 10-hour procedural vote, the longest in House history, saw GOP lawmakers flip-flop on major crypto bills amid late-night talks. By Decrypt 2025-07-17
Canadian Bitcoin firm Matador eyes 6K Bitcoin treasury by 2027 !Canadian Bitcoin firm Matador eyes 6K Bitcoin treasury by 2027imagesnewscanadian-bitcoin-firm-matador-eyes-6k-bitcoin-trea3ad3638e29ce.jpg Matador … By Cointelegraph 2025-07-17
Bank of America CEO Says Still Too Early For Stablecoin Plans as US Stalls on Key Crypto Rules Bank of America is holding back on stablecoins, with CEO Brian Moynihan citing regulatory uncertainty and limited customer demand. By Decrypt 2025-07-17
Retail waking up? Coinbase rockets to rank 137 in App Store !Retail waking up? Coinbase rockets to rank 137 in App Storeimagesnewsretail-waking-up-coinbase-rockets-to-rank-137-in-a951e20049e85.jpg The rise in … By Cointelegraph 2025-07-17
Coinbase Wallet is now Base app, a crypto ‘everything app' !Coinbase Wallet is now Base app, a crypto everything appimagesnewscoinbase-wallet-is-now-base-app-a-crypto-everythind1558c6a00b3.jpg Coinbase is … By Cointelegraph 2025-07-17
US spot Ether ETFs post new record inflow as altcoins pump !US spot Ether ETFs post new record inflow as altcoins pumpimagesnewsus-spot-ether-etfs-post-new-record-inflow-as-altco1bad82a0773a.jpg US Spot Ether … By Cointelegraph 2025-07-17
Whatever Happened to the Bitcoin and Ethereum Sweater Guys? The 2017 photo of two friends in crypto-themed sweaters became iconic. Eight years later, both men are still in the industry. By Decrypt 2025-07-17
Massive OG Bitcoin whale shifts another $4.7B of BTC to new wallet !Massive OG Bitcoin whale shifts another 4.7B of BTC to new walletimagesnewsmassive-og-bitcoin-whale-shifts-another-4-7b-of-btd4b0e1fbdb9d.jpg … By Cointelegraph 2025-07-17
Crypto bills move forward after nine-hour stalemate on House floor !Crypto bills move forward after nine-hour stalemate on House floorimagesnewscrypto-bills-move-forward-after-nine-hour-stalematbed71e26ffcb.jpg The … By Cointelegraph 2025-07-17
Trump’s World Liberty crypto tokens are set to become tradable !Trumps World Liberty crypto tokens are set to become tradableimagesnewstrumps-world-liberty-crypto-tokens-are-set-to-beco2a3cd2b768a7.jpg … By Cointelegraph 2025-07-17
Trump-Backed World Liberty Ethereum Tokens Are Set to Hit the Market After a Wednesday vote, users will soon be able to buy and sell the Ethereum-based WLFI. By Decrypt 2025-07-17
TON news update: TAC mainnet launch could send the altcoin to $3.50 !TON news update TAC mainnet launch could send the altcoin to 3.50imagesnewston-news-update-tac-mainnet-launch-could-send-the-a207f6d1e2a2.jpg TON … By Cointelegraph 2025-07-16
Hate Making Phone Calls? Google’s AI Will Make Them for You Google adds AI tools to Search that make calls and answer complex queries on users behalf, but experts warn about the hidden cost. By Decrypt 2025-07-16
SEC Delays Decision on Bitwise Bitcoin, Ethereum ETFs' In-kind Redemptions The regulator will rule on the request by the issuer on September 8. By Decrypt 2025-07-16
Citi Considers Launching Stablecoin as TradFi Players Continue Crypto Embrace Citis CEO revealed this week that the multinational bank is considering developing a stablecoin for cross-border payments. By Decrypt 2025-07-16
Coinbase and Strategy Set Stock Records Amid Bitcoin, Ethereum Spikes Amid major moves by Bitcoin, Ethereum, XRP, and other top coins, Coinbase and Strategy both set stock records on Wednesday. By Decrypt 2025-07-16
Trump Media files AI trademarks to expand Truth Social, present ‘non-woke’ news !Trump Media files AI trademarks to expand Truth Social, present non-woke … By Cointelegraph 2025-07-16
Hyperliquid Strategies Inc. plan for $583M treasury boosts HYPE price !Hyperliquid Strategies Inc. plan for 583M treasury boosts HYPE priceimagesnewshyperliquid-strategies-inc-plan-for-583m-treasury-309010af126f.jpg … By Cointelegraph 2025-07-16
UK lawmakers push to ban crypto donations in political campaigns !UK lawmakers push to ban crypto donations in political campaignsimagesnewsuk-lawmakers-push-to-ban-crypto-donations-in-polit9b7fea0ebaef.jpg With … By Cointelegraph 2025-07-16
Bitcoin resistance at $120K normal due to ‘frothy’ open interest near all-time highs !Bitcoin resistance at 120K normal due to frothy open interest near all-time … By Cointelegraph 2025-07-16
Talos acquires Coin Metrics in $100M deal !Talos acquires Coin Metrics in 100M dealimagesnewstalos-acquires-coin-metrics-in-100m-dealfc295e3794b7.jpg The 100M acquisition brings Coin Metrics … By Cointelegraph 2025-07-16
‘There is no legitimate use case for crypto’ — US Representative Stephen Lynch !There is no legitimate use case for crypto US Representative Stephen … By Cointelegraph 2025-07-16
XRP Price Hits 6-Month High as Open Interest Soars to Record Levels Investors are racing to price in how the cryptocurrency could benefit from regulatory tailwinds and institutional adoption, analysts say. By Decrypt 2025-07-16
Roman Storm prosecutors seek to block testimony on crypto kidnappings !Roman Storm prosecutors seek to block testimony on crypto kidnappingsimagesnewsroman-storm-prosecutors-seek-to-block-testimony-ondb7a1bb7bce1.jpg US … By Cointelegraph 2025-07-16
SOL news update: Will multi-exchange liquid staking trigger rally to $185? !SOL news update Will multi-exchange liquid staking trigger rally to 185?imagesnewssol-news-update-will-multi-exchange-liquid-stakingb25b83eb84d4.jpg … By Cointelegraph 2025-07-16
'Bitcoin Jesus' Roger Ver sues Spain to block extradition to the United States !Bitcoin Jesus Roger Ver sues Spain to block extradition to the United … By Cointelegraph 2025-07-16
New Calamos Bitcoin ETF to use options strategy tied to five major BTC funds !New Calamos Bitcoin ETF to use options strategy tied to five major BTC … By Cointelegraph 2025-07-16
ARK Invest Sells $8.7 Million Worth of Bitcoin ETF Shares Taking Profits ARKB had 6.2 million in outflows as Bitcoin ETFs overall added 403 million, marking nine straight days of inflows across the sector. By Decrypt 2025-07-16
Ethereum Forms 'Golden Cross', With Bulls in Control: Analysis The price of Ethereum has broken past a key resistance zone, forming a golden cross pattern that traders often like. By Decrypt 2025-07-16
Upexi Stock Surges as Solana Climbs—Why the Firm Is Bullish on SOL Consumer products firm Upexi is now focused on accumulating Solanaand apparently reaping the rewards, with UPXI stock up nearly 39 on Wednesday. By Decrypt 2025-07-16
Bitcoin price to $150K? Here’s what it will take !Bitcoin price to 150K? Heres what it will takeimagesnewsbitcoin-price-to-150k-heres-what-it-will-take9afd3132ad12.jpg Bitcoin bulls are making a run … By Cointelegraph 2025-07-16
Ethereum Shorts Rekt as ETH Price Keeps Climbing Meanwhile, ETH futures volume has jumped 27 as open interest keeps rising. By Decrypt 2025-07-16
'Bitcoin Jesus' Roger Ver Sues Spain to Block Extradition Over US Tax Charges: Bloomberg Bitcoin icon Roger Ver sued Spain for allegedly violating his legal protections, after it ruled he could be extradited to the United States. By Decrypt 2025-07-16
TRUMP memecoins set to be unlocked amid ‘crypto week’ votes !TRUMP memecoins set to be unlocked amid crypto week votesimagesnewstrump-memecoins-set-to-be-unlocked-amid-crypto-weec8dda2bc1b0a.jpg US President … By Cointelegraph 2025-07-16
Talos to Buy Coin Metrics Amid Surge in Crypto M&A Activity The provider of institutional trading technology completed two deals last year. By Decrypt 2025-07-16
EU Anti-Money Laundering Authority Warns Crypto Firms of New Regulations The chair of the EUs Anti-Money Laundering Authority AMLA noted the fragmented EU crypto markets, and the risk of the diverging application of rules. By Decrypt 2025-07-16
There’s more to Ripple than the ‘XRP Army’: Why the altcoin is a good trade !Theres more to Ripple than the XRP Army Why the altcoin is a good tradeimagesnewstheres-more-to-ripple-than-the-xrp-army-why-the-aleb62a1684efd.jpg … By Cointelegraph 2025-07-16
Bitcoin Wavers After Trump Says He's 'Not Planning' to Fire Fed Chair Experts say that testing the Feds independence could be bad for stocks and bonds, but a boon for assets like Bitcoin. By Decrypt 2025-07-16
Crypto Bills in Limbo After Dramatic Standoff on House Floor Holdout Republicans are pouring cold water on Crypto Week. By Decrypt 2025-07-16
Three US crypto bills revived after initial failure in House vote !Three US crypto bills revived after initial failure in House voteimagesnewsthree-us-crypto-bills-revived-after-initial-failur7188384b3003.jpg Though … By Cointelegraph 2025-07-16
BoA exploring stablecoins to help move trillions in client transactions, CEO says !BoA exploring stablecoins to help move trillions in client transactions, CEO … By Cointelegraph 2025-07-16
Dogecoin Rises as Pump.fun Token, Official Trump and Melania Meme Coins Jump Meme coins are rising fast as the crypto market rebounds from a one-day selloff, with Dogecoin leading the charge. By Decrypt 2025-07-16
Bitcoin digests US PPI win with $120K liquidity grab on bulls' radar !Bitcoin digests US PPI win with 120K liquidity grab on bulls radarimagesnewsbitcoin-digests-us-ppi-win-with-120k-liquidity-gra9600976f68f9.jpg … By Cointelegraph 2025-07-16
Ethereum’s ‘Trustware’ era could push ETH to $15.8K — Consensys !Ethereums Trustware era could push ETH to 15.8K Consensysimagesnewsethereums-trustware-era-could-push-eth-to-15-8k-co1b01bf4ada5c.jpg As Ethereum … By Cointelegraph 2025-07-16
This trader turned $6.8K into $1.5M by using a high-risk strategy: Here’s how !This trader turned 6.8K into 1.5M by using a high-risk strategy Heres … By Cointelegraph 2025-07-16
DEA, FBI Have Seized $10 Million in Crypto From Mexican Drug Cartel Sinaloa This Year A quarterly report from the DOJ reveals Mexican Sinaloa cartel was raided in 2025 and agents seized 10 million in crypto in Miami, Florida. By Decrypt 2025-07-16
EU sanctions crypto entities for election interference, disinformation !EU sanctions crypto entities for election interference, disinformationimagesnewseu-sanctions-crypto-entities-for-election-interfer90f549451581.jpg … By Cointelegraph 2025-07-16
Bitcoin 'not at peak yet': Watch these BTC price levels next !Bitcoin not at peak yet Watch these BTC price levels nextimagesnewsbitcoin-not-at-peak-yet-watch-these-btc-price-leve027a1676c772.jpg Bitcoin price … By Cointelegraph 2025-07-16
Waterfall Network: Exploring a New Path to Blockchain Scalability Through a DAG-Based Architecture !Waterfall Network Exploring a New Path to Blockchain Scalability Through a DAG-Based … By Cointelegraph 2025-07-16
Franklin Templeton-backed Bitlayer rolls out Bitcoin bridge on mainnet !Franklin Templeton-backed Bitlayer rolls out Bitcoin bridge on mainnetimagesnewsfranklin-templeton-backed-bitlayer-rolls-out-bitco423229ccbb43.jpg … By Cointelegraph 2025-07-16
How a Russian national allegedly laundered $530M in crypto via Tether !How a Russian national allegedly laundered 530M in crypto via Tetherimagesnewshow-a-russian-national-allegedly-laundered-530m-in452bdd7bf3d5.jpg … By Cointelegraph 2025-07-16
Bank of England Governor Doubts the UK Needs a 'Britcoin' CBDC BoE Governor Bailey casts doubt on digital pound necessity, warns against stablecoins undermining fiat currencies. By Decrypt 2025-07-16
WLF investor Aqua1 offers few answers to alleged Web3Port ties !WLF investor Aqua1 offers few answers to alleged Web3Port tiesimagesnewswlf-investor-aqua1-offers-few-answers-to-alleged-w4d24eb3ebd23.jpg World … By Cointelegraph 2025-07-16
Cathie Wood’s ARK dumps its Bitcoin ETF after split-adjusted ATH !Cathie Woods ARK dumps its Bitcoin ETF after split-adjusted ATHimagesnewscathie-woods-ark-dumps-its-bitcoin-etf-after-splitba8c0f9a72dc.jpg ARKs … By Cointelegraph 2025-07-16
Ethereum open interest hits all-time high as trader predicts $30K price top !Ethereum open interest hits all-time high as trader predicts 30K price … By Cointelegraph 2025-07-16
California Forms Tech Task Force With Ripple, Coinbase Participation The states new initiative draws in crypto firms to help overhaul its operations and explore blockchains role in public-sector innovation. By Decrypt 2025-07-16
Bitcoin BIP proposes quantum-resistant upgrade by 2030 !Bitcoin BIP proposes quantum-resistant upgrade by 2030imagesnewsbitcoin-bip-proposes-quantum-resistant-upgrade-by-588fb6064f9e.jpg New BIP proposes … By Cointelegraph 2025-07-16
Liquid staking token launches on Solana with support from Coinbase, Kraken, Galaxy !Liquid staking token launches on Solana with support from Coinbase, Kraken, … By Cointelegraph 2025-07-16
BNB Chain targets 5,000 DEX swaps per second in 2025 !BNB Chain targets 5,000 DEX swaps per second in 2025imagesnewsbnb-chain-targets-5000-dex-swaps-per-second-in-2023e4c4dba9785.jpg BNB Chain also … By Cointelegraph 2025-07-16
Bulgaria missed $25B debt payoff by selling Bitcoin in 2018 !Bulgaria missed 25B debt payoff by selling Bitcoin in 2018imagesnewsbulgaria-missed-25b-debt-payoff-by-selling-bitcoin3ca830277e2a.jpg Bulgarias … By Cointelegraph 2025-07-16
Ethereum's ‘crucial’ breakout hints at 30% rally versus Bitcoin next !Ethereums crucial breakout hints at 30 rally versus Bitcoin nextimagesnewsethereum-s-crucial-breakout-hints-at-30-rally-versdd306361e067.jpg … By Cointelegraph 2025-07-16
Ethereum Pumps To Five-Month High As Treasury Companies Stockpile ETH Ethereum hit its highest price since February on Wednesday, as two public companies stockpiled ETH amid a broader crypto treasury trend. By Decrypt 2025-07-16
Crypto spot trading down 22% in Q2 despite Bitcoin rally: Report !Crypto spot trading down 22 in Q2 despite Bitcoin rally Reportimagesnewscrypto-spot-trading-down-22-in-q2-despite-bitcoin-28e8d8679aca.jpg While … By Cointelegraph 2025-07-16
EU Sanctions A7 Crypto Network Tied to Russian Election Interference The sanctions put pressure on third-country actors to prioritize access to A7 or their relationships with the EU and UK. By Decrypt 2025-07-16
Can Bitcoin’s hard cap of 21 million be changed? !Can Bitcoins hard cap of 21 million be changed?imagesnewscan-bitcoins-hard-cap-of-21-million-be-changed3175fd4dbd15.jpg Explore the history of … By Cointelegraph 2025-07-16
DEA, FBI bust Sinaloa cartel, confiscate $10M in cryptocurrency !DEA, FBI bust Sinaloa cartel, confiscate 10M in cryptocurrencyimagesnewsdea-fbi-bust-sinaloa-cartel-confiscate-10m-in-cryp10de4fcac531.jpg US … By Cointelegraph 2025-07-16
Arizona, Texas, Utah leading in US crypto policy: Chainlink !Arizona, Texas, Utah leading in US crypto policy Chainlinkimagesnewsarizona-texas-utah-leading-in-us-crypto-policy-cha5990e972d8fe.jpg At least 50 … By Cointelegraph 2025-07-16
Bitcoin ETF inflows show institutions ‘doubled down’ on BTC at $116K !Bitcoin ETF inflows show institutions doubled down on BTC at 116Kimagesnewsbitcoin-etf-inflows-show-institutions-doubled-downd66edd00bff2.jpg … By Cointelegraph 2025-07-16
CLARITY Act isn’t perfect, but it’s the bill US Congress must pass this summer !CLARITY Act isnt perfect, but its the bill US Congress must pass this … By Cointelegraph 2025-07-16
Vitalik Buterin proposes minimalism as key to layer-2 blockchain success !Vitalik Buterin proposes minimalism as key to layer-2 blockchain successimagesnewsvitalik-buterin-proposes-minimalism-as-key-to-layea77cafb5ba01.jpg … By Cointelegraph 2025-07-16
CLARITY Act explained: What it means for Crypto Week and beyond !CLARITY Act explained What it means for Crypto Week and beyondimagesnewsclarity-act-explained-what-it-means-for-crypto-weed10abed715db.jpg The … By Cointelegraph 2025-07-16
Crosschain swaps move $21B in illicit funds, up 200% in two years: Elliptic !Crosschain swaps move 21B in illicit funds, up 200 in two years Ellipticimagesnewscrosschain-swaps-move-21b-in-illicit-funds-up-200-433cc7ef210f.jpg … By Cointelegraph 2025-07-16
Crypto exchange BigONE loses $27M in third-party attack !Crypto exchange BigONE loses 27M in third-party attackimagesnewscrypto-exchange-bigone-loses-27m-in-third-party-at19539c282d11.jpg BigONE crypto … By Cointelegraph 2025-07-16
BitMine surges after-hours as Peter Thiel discloses 9% stake !BitMine surges after-hours as Peter Thiel discloses 9 stakeimagesnewsbitmine-surges-after-hours-as-peter-thiel-disclosedaa8202336be.jpg Billionaire … By Cointelegraph 2025-07-16
‘99% chance’ Bitcoin dominance has peaked if Ethereum surge continues !99 chance Bitcoin dominance has peaked if Ethereum surge continuesimagesnews99-chance-bitcoin-dominance-has-peaked-if-ethereum8858bbe6603b.jpg The … By Cointelegraph 2025-07-16
Trump Pushes House GOP to Revive Vote on Crypto Bills Trump should focus on building a national Bitcoin reserve instead of pushing stablecoin regulation, Decrypt was told. By Decrypt 2025-07-16
Michigan town puts pre-emptive curbs on crypto ATMs !Michigan town puts pre-emptive curbs on crypto ATMsimagesnewsmichigan-town-puts-pre-emptive-curbs-on-crypto-atme95fe4e2ef1d.jpg The town of Grosse … By Cointelegraph 2025-07-16
GameStop CEO teases crypto payments, says Bitcoin buys are inflation hedge !GameStop CEO teases crypto payments, says Bitcoin buys are inflation … By Cointelegraph 2025-07-16
Bitcoin Stalls as Traders Book Profits Amid Jerome Powell Succession Talks Bitcoins 5 correction from all-time highs comes as sticky inflation and talk of Fed Chair Jerome Powells replacement lingers. By Decrypt 2025-07-16
Block Earner Launches Australia’s ‘First’ Bitcoin-Backed Home Loan The product allows crypto holders to finance property deposits using Bitcoin as collateral, all without having to sell their stash. By Decrypt 2025-07-16
Peter Thiel Bets Big on Ethereum, Buys Stake in Treasury Firm Chaired by Fundstrat's Tom Lee The development comes as interest in Ethereum reserves rises, with BitMine surpassing 500 million in holdings. By Decrypt 2025-07-16
Cantor Fitzgerald plans $3.5B Bitcoin buy from Adam Back’s Blockstream: Reports !Cantor Fitzgerald plans 3.5B Bitcoin buy from Adam Backs Blockstream … By Cointelegraph 2025-07-16
Bitcoin ‘increasingly unlikely’ to see prolonged correction: 21Shares !Bitcoin increasingly unlikely to see prolonged correction 21Sharesimagesnewsbitcoin-increasingly-unlikely-to-see-prolonged-cor7641a1f42d38.jpg … By Cointelegraph 2025-07-16
House GOP plans quick re-vote on crypto bills amid CBDC dispute !House GOP plans quick re-vote on crypto bills amid CBDC disputeimagesnewshouse-gop-plans-quick-re-vote-on-crypto-bills-amid700868ff9975.jpg House … By Cointelegraph 2025-07-16
Meet the Microwave Weapon That Zaps Swarms of Drones From the Sky Leonidas, a high-powered microwave system, disables drones mid-air without using bullets or lasers, and the Pentagon is paying attention. By Decrypt 2025-07-16
Cantor Fitzgerald SPAC in Talks for $4B Bitcoin Deal With Blockstream’s Adam Back: FT The deal would position Cantor as a major Bitcoin buyer, expanding its SPAC-led crypto strategy amid renewed political support. By Decrypt 2025-07-16
JP Morgan Dives Deeper into Stablecoins Despite Jamie Dimon Doubts JP Morgan eyes stablecoins as U.S. legislation advances and the potential market grows. By Decrypt 2025-07-15
Ethereum Climbs While Bitcoin Falls After Record Surge—Here's Why Ethereum continued its recent momentum, rising even as Bitcoin retreated and fell to its lowest point in five days. By Decrypt 2025-07-15
Uniswap President Mary-Catherine Lader steps down after 4 years !Uniswap President Mary-Catherine Lader steps down after 4 yearsimagesnewsuniswap-president-mary-catherine-lader-steps-down-f729f58fd81e.jpg Lader … By Cointelegraph 2025-07-15
Institutions Are Stocking Up on Bitcoin, Ethereum as Retail Interest Cools: Wintermute The crypto market is maturing thanks to greater institutional adoption. By Decrypt 2025-07-15
Hypercharged Exposure to XRP and Solana Now Available With These Two ETFs ProShares Debuts Leveraged XRP, Solana ETFs, but they arent for the risk-averse. By Decrypt 2025-07-15
Prosecutors link Roman Storm to DPRK hackers in trial opening statements !Prosecutors link Roman Storm to DPRK hackers in trial opening statementsimagesnewsprosecutors-link-roman-storm-to-dprk-hackers-in-trf29f7d84afce.jpg … By Cointelegraph 2025-07-15
Ether holding $3K opens door to 1,100% ‘vertical phase’ rally: Analyst !Ether holding 3K opens door to 1,100 vertical phase rally Analystimagesnewsether-holding-3k-opens-door-to-1100-vertical-phasecae6aeaa0355.jpg Ether … By Cointelegraph 2025-07-15
‘Existential Threat’: Bitcoin Proposal Would Freeze Satoshi’s Quantum-Vulnerable Coins The proposal argues that an unprecedented threat requires Bitcoins community to take unprecedented action. By Decrypt 2025-07-15
Legacy finance discovers stablecoins as JPMorgan, Citigroup consider market entry !Legacy finance discovers stablecoins as JPMorgan, Citigroup consider market … By Cointelegraph 2025-07-15
XRP Smashes Key Price Barrier, Flashing Bullish Signs: Analysis XRP is on fire, with the price of the token rocketing past key resistance levels and currently outperforming Bitcoin and Ethereum. By Decrypt 2025-07-15
Crypto-backed group gathers $141M funding to influence US elections !Crypto-backed group gathers 141M funding to influence US electionsimagesnewscrypto-backed-group-gathers-141m-funding-to-influe74c87a6394e8.jpg … By Cointelegraph 2025-07-15
Bitcoin dips as June CPI confirms sticky inflation trend: Are BTC dips for buying? !Bitcoin dips as June CPI confirms sticky inflation trend Are BTC dips for … By Cointelegraph 2025-07-15
Crypto Market Structure Bill Will Kill DeFi in the US, Industry Leaders Say DeFi stakeholders say they can no longer stay silent about major concerns with the CLARITY Act, which will see a vote as soon as tomorrow. By Decrypt 2025-07-15
ETH news update: Bulls target $3.4K, citing ETF flows and treasury buying as the fuel !ETH news update Bulls target 3.4K, citing ETF flows and treasury buying as the … By Cointelegraph 2025-07-15
GameStop CEO Ryan Cohen Talks Bitcoin Strategy, Teases Potential Crypto Payments Is GameStop trying to be the next Strategy? CEO Ryan Cohen gives a look into its Bitcoin treasury approach and talks crypto payments. By Decrypt 2025-07-15
Bitcoin bear Vanguard is now the largest shareholder of Strategy !Bitcoin bear Vanguard is now the largest shareholder of Strategyimagesnewsbitcoin-bear-vanguard-is-now-the-largest-sharehold41056fc9cc8e.jpg Despite … By Cointelegraph 2025-07-15
Bitcoin profit taking sets traders’ buy target at $113K: Will a rally to new highs follow? !Bitcoin profit taking sets traders buy target at 113K Will a rally to new highs … By Cointelegraph 2025-07-15
First crypto bill vote fails to get 100% Republican support despite Trump’s call !First crypto bill vote fails to get 100 Republican support despite Trumps … By Cointelegraph 2025-07-15
Kraken launches US crypto derivatives platform in wake of NinjaTrader acquisition !Kraken launches US crypto derivatives platform in wake of NinjaTrader … By Cointelegraph 2025-07-15
PUMP TOKEN DEBUTS AT $5.5B FDV, PENGU LEADS ALL MOVERS, ETH OUTPREFORMS DOGE leads majors in crypto selloff. Banks can hold crypto under strict rules Fed. Whale sends 2b BTC to Galaxy Digital for sale. Sequans buys 79m … By Decrypt 2025-07-15
New Zealand woman accused of killing mother after stealing cash for crypto !New Zealand woman accused of killing mother after stealing cash for … By Cointelegraph 2025-07-15
XRP news update: Uptick in whale volumes could catalyze rally to $4 !XRP news update Uptick in whale volumes could catalyze rally to 4imagesnewsxrp-news-update-uptick-in-whale-volumes-could-cata6fda3f1050b5.jpg XRP … By Cointelegraph 2025-07-15
Ripple, Coinbase, MoonPay execs to advise California on gov’t efficiency !Ripple, Coinbase, MoonPay execs to advise California on govt efficiencyimagesnewsripple-coinbase-moonpay-execs-to-advise-california55f45d0ff2d1.jpg … By Cointelegraph 2025-07-15
Pump.fun Token Tops $2 Billion in Market Cap Following Massive ICO—But It Hasn't Caught Bonk Yet Most public sale participants either sold or transferred their PUMP tokens on its first day, following Pump.funs massive ICO. By Decrypt 2025-07-15
SharpLink Adds $225 Million in Ethereum to Industry-Leading ETH Treasury The company started accumulating the asset just over a month ago. By Decrypt 2025-07-15
The Bitcoin treasury model is breaking, but Strategy’s isn’t. Here’s why !The Bitcoin treasury model is breaking, but Strategys isnt. Heres why imagesnewsthe-bitcoin-treasury-model-is-breaking-but-strateg9177d0a30193.jpg … By Cointelegraph 2025-07-15
Polymarket Investigations Dropped by Justice Department, CFTC: Bloomberg U.S. authorities have stopped investigating crypto prediction markets platform Polymarket, Bloomberg reported Tuesday. By Decrypt 2025-07-15
US Justice Department, CFTC end Polymarket investigations — Report !US Justice Department, CFTC end Polymarket investigations Reportimagesnewsus-justice-department-cftc-end-polymarket-investigab970112b988.jpg With … By Cointelegraph 2025-07-15
CRYPTO DIPS, STOCKS KEEP HITTING ATHS, SHARPLINK TOP ETH HOLDER DOGE leads majors in crypto selloff. Banks can hold crypto under strict rules Fed. Whale sends 2b BTC to Galaxy Digital for sale. Sequans buys 79m … By Decrypt 2025-07-15
Bitcoin‘s ‘most reliable reversal pattern’ hints at BTC price rally toward $160K !Bitcoins most reliable reversal pattern hints at BTC price rally toward … By Cointelegraph 2025-07-15
Programmable regulation is the missing key to DeFi’s legal future !Programmable regulation is the missing key to DeFis legal futureimagesnewsprogrammable-regulation-is-the-missing-key-to-defia380dd27a05b.jpg … By Cointelegraph 2025-07-15
BBVA expands crypto access in Spain: Here’s what changed !BBVA expands crypto access in Spain Heres what changedimagesnewsbbva-expands-crypto-access-in-spain-heres-what-cha3f4b603c8b47.jpg Spains BBVA opens … By Cointelegraph 2025-07-15
XRP price can see 'quick' run to new all-time highs if price breaks $3 !XRP price can see quick run to new all-time highs if price breaks 3imagesnewsxrp-price-can-see-quick-run-to-new-all-time-highs-dbb053165dee.jpg XRP … By Cointelegraph 2025-07-15
MiCA a blessing in disguise for EU crypto investors and exchanges !MiCA a blessing in disguise for EU crypto investors and exchangesimagesnewsmica-a-blessing-in-disguise-for-eu-crypto-investor0e0983f7ae71.jpg The … By Cointelegraph 2025-07-15
4 countries that let you buy citizenship or a golden visa with crypto !4 countries that let you buy citizenship or a golden visa with cryptoimagesnews4-countries-that-let-you-buy-citizenship-or-a-gold2a5e36619092.jpg … By Cointelegraph 2025-07-15
James Wynn returns with $19M leveraged Bitcoin long, $100K PEPE bet !James Wynn returns with 19M leveraged Bitcoin long, 100K PEPE betimagesnewsjames-wynn-returns-with-19m-leveraged-bitcoin-long79ef5c84d3ac.jpg Wynn … By Cointelegraph 2025-07-15
Ripple confirms intention to pursue MiCA license for EU expansion !Ripple confirms intention to pursue MiCA license for EU expansionimagesnewsripple-confirms-intention-to-pursue-mica-license-feb62a1684efd.jpg Ripple … By Cointelegraph 2025-07-15
Dormant Satoshi-Era Bitcoin Whale Moves $4 Billion—But It May Not Be a Sell-Off Indicator Dormant Bitcoin whale from 2011 awakens, moving 4.7 billion to exchanges amid speculation of potential massive sell-off. By Decrypt 2025-07-15
Standard Chartered Now Offers Institutional Bitcoin, Ethereum Trading—Here's What It Means The banking giant has opened Bitcoin and Ethereum trading to institutions through the same systems they use for dollars, euros, and yen. By Decrypt 2025-07-15
Ethereum becomes preferred treasury asset for tech-savvy firms: Ray Youssef !Ethereum becomes preferred treasury asset for tech-savvy firms Ray … By Cointelegraph 2025-07-15
Dogecoin Leads Losses Amid ‘Profit Taking’ Following Bitcoin's All-Time High The crypto market slipped Tuesday morning in a classic breakout-pullback sequence, in the wake of Bitcoins record 123,000 high. By Decrypt 2025-07-15
Core introduces first revenue-sharing model for stablecoin issuers, devs !Core introduces first revenue-sharing model for stablecoin issuers, devsimagesnewscore-introduces-first-revenue-sharing-model-for-stf4c7f2b81d89.jpg … By Cointelegraph 2025-07-15
‘League of Kingdoms’ Expands Into ‘Arena-Z’ as New Games and Tokens Emerge The Arena-Z ecosystem will feature two additional League of Kingdoms games, a fresh A2Z token, and more. Heres what to expect. By Decrypt 2025-07-15
BlackRock’s crypto inflows jump 370% in Q2 while net flows slump !BlackRocks crypto inflows jump 370 in Q2 while net flows slumpimagesnewsblackrocks-crypto-inflows-jump-370-in-q2-while-net32106f9a627c.jpg … By Cointelegraph 2025-07-15
OpenSea CTO outlines token trading vision for moving beyond NFTs !OpenSea CTO outlines token trading vision for moving beyond NFTsimagesnewsopensea-cto-outlines-token-trading-vision-for-moviaef03c9d1cd8.jpg … By Cointelegraph 2025-07-15
Pudgy Penguins' PENGU Token Doubles in a Week Amid ETF Hype The PENGU meme coin has posted one of the weeks biggest gains, but questions remain over its long-term viability in the current market. By Decrypt 2025-07-15
MARA follows Saylor’s playbook with Two Prime deal, BTC allocation grows !MARA follows Saylors playbook with Two Prime deal, BTC allocation growsimagesnewsmara-follows-saylors-playbook-with-two-prime-deal-68d97e36ff01.jpg … By Cointelegraph 2025-07-15
Debunked: Pump.fun’s $500M presale funds are not locked !Debunked Pump.funs 500M presale funds are not lockedimagesnewsdebunked-pump-funs-500m-presale-funds-are-not-lockffbe04d8f9f3.jpg Spreading claims … By Cointelegraph 2025-07-15
Ethereum DeFi connects to TON and Telegram with Tac mainnet launch !Ethereum DeFi connects to TON and Telegram with Tac mainnet launchimagesnewsethereum-defi-connects-to-ton-and-telegram-with-ta854836d58cee.jpg … By Cointelegraph 2025-07-15
Satoshi-era whale moves $4.6B in Bitcoin after 14-year HODL !Satoshi-era whale moves 4.6B in Bitcoin after 14-year HODLimagesnewssatoshi-era-whale-moves-4-6b-in-bitcoin-after-14-yc2c3c77d8bf0.jpg The … By Cointelegraph 2025-07-15
Bitcoin speculators’ record cost basis boosts $100K support as BTC dives !Bitcoin speculators record cost basis boosts 100K support as BTC divesimagesnewsbitcoin-speculators-record-cost-basis-boosts-100k-64ca5d48f325.jpg … By Cointelegraph 2025-07-15
Bitcoin price drop to $114K possible as BTC whales take profits !Bitcoin price drop to 114K possible as BTC whales take profitsimagesnewsbitcoin-price-drop-to-114k-possible-as-btc-whales-696fb1da9509.jpg Bitcoin … By Cointelegraph 2025-07-15
South Korean court clears Wemade ex-CEO in Wemix manipulation case !South Korean court clears Wemade ex-CEO in Wemix manipulation caseimagesnewssouth-korean-court-clears-wemade-ex-ceo-in-wemix-me68ff60f805f.jpg After … By Cointelegraph 2025-07-15
Standard Chartered launches Bitcoin and Ether trading for institutions !Standard Chartered launches Bitcoin and Ether trading for institutionsimagesnewsstandard-chartered-launches-bitcoin-and-ether-trade2e8ec252840.jpg … By Cointelegraph 2025-07-15
Arcadia Finance exploited, $2.5M stolen and converted to WETH !Arcadia Finance exploited, 2.5M stolen and converted to WETHimagesnewsarcadia-finance-exploited-2-5m-stolen-and-converteb55b279b9005.jpg Arcadia … By Cointelegraph 2025-07-15
Can AI bots steal your crypto? The rise of digital thieves !Can AI bots steal your crypto? The rise of digital thievesimagesnewscan-ai-bots-steal-your-crypto-the-rise-of-digital-cc0acd9fce10.jpg Discover how … By Cointelegraph 2025-07-15
LA sheriff deputies admit to helping crypto ‘Godfather’ extort victims !LA sheriff deputies admit to helping crypto Godfather extort victimsimagesnewsla-sheriff-deputies-admit-to-helping-crypto-godfatb4674ebca61d.jpg The … By Cointelegraph 2025-07-15
Ethereum investors pile into ETH amid massive weekly surge !Ethereum investors pile into ETH amid massive weekly surgeimagesnewsethereum-investors-pile-into-eth-amid-massive-weeke3db3f880f88.jpg Ethereum … By Cointelegraph 2025-07-15
Bitcoin Trading at Centre of High-Profile New Zealand Homicide Case Records show the New Zealand woman used fake crypto screenshots to convince her mother the investment had generated 160,000 profit. By Decrypt 2025-07-15
One LA Sheriff’s Deputy Charged, Another Pleads Guilty in Crypto ‘Godfather’ Case The officers staged fake raids and used fraudulent warrants to track victims for The Godfathers criminal enterprise, prosecutors alleged. By Decrypt 2025-07-15
These Economic Forces Could Help Lift Bitcoin Higher Bitcoins record rally could receive another boost as the global bond crisis heats up with Japans 30Y yields hitting new highs. By Decrypt 2025-07-15
Bitcoin could rally to $135K before ‘corrective phase’ — Analyst !Bitcoin could rally to 135K before corrective phase Analystimagesnewsbitcoin-could-rally-to-135k-before-corrective-phasd97b0c4fcbfe.jpg Fairlead … By Cointelegraph 2025-07-15
Rep. Maxine Waters Opines on Upcoming US Crypto Bills: 'I Told You So' Rep. Maxine Waters has warned two pending crypto bills could gut consumer protections and hand more power to politically connected players. By Decrypt 2025-07-15
Unauthorized crypto trading now carries 2 years of prison in Hungary !Unauthorized crypto trading now carries 2 years of prison in Hungaryimagesnewsunauthorized-crypto-trading-now-carries-2-years-of9a7b1eac15e7.jpg … By Cointelegraph 2025-07-15
Bitcoin-fueled darknet marketplace vanishes in possible exit scam !Bitcoin-fueled darknet marketplace vanishes in possible exit scamimagesnewsbitcoin-fueled-darknet-marketplace-vanishes-in-pos754b93aa5866.jpg Abacus … By Cointelegraph 2025-07-15
Even retail demand is now outpacing Bitcoin supply: Bitfinex !Even retail demand is now outpacing Bitcoin supply Bitfineximagesnewseven-retail-demand-is-now-outpacing-bitcoin-supply33bee9c69336.jpg Bitfinex … By Cointelegraph 2025-07-15
Grok Went MechaHitler and Elmo Said Hold My Beer The incident follows a previous issue with Grok last week, which began responding with hate-filled speech to users on X. By Decrypt 2025-07-15
FOMO, lax rules are fueling the crypto crime supercycle !FOMO, lax rules are fueling the crypto crime supercycleimagesnewsfomo-lax-rules-are-fueling-the-crypto-crime-superca0ab6b13d3a3.jpg Retired DEA … By Cointelegraph 2025-07-14
'Artificial Gooning Intelligence': Elon Musk's xAI Launches Waifu Companions for Grok xAIs new Companions feature brings anime waifus to Grok subscribers, sparking everything from marriage proposals to existential dread about humanitys … By Decrypt 2025-07-14
Coinbase Stock Hits Record High Alongside Bitcoin as Analysts Highlight 'Growth Runway' Argus Research said in a new note that the expected passing of the GENIUS Act will likely act as an impetus for growth for Coinbase. By Decrypt 2025-07-14
US Federal agencies outline key risks for banks eyeing crypto custody !US Federal agencies outline key risks for banks eyeing crypto custodyimagesnewsus-federal-agencies-outline-key-risks-for-banks-eyec047843bea0.jpg … By Cointelegraph 2025-07-14
Despite Grok's 'MechaHitler' Meltdown, Elon Musk’s xAI Scores $200M Pentagon Deal The U.S. Department of Defense has awarded xAI a lucrative deal just days after the Grok chatbot spewed antisemitism, sparking concern. By Decrypt 2025-07-14
Congress opens crypto bill debate with claims of ‘GOP giveaway’ to industry !Congress opens crypto bill debate with claims of GOP giveaway to … By Cointelegraph 2025-07-14
BitMine Stock Spikes, Then Sags After Bitcoin Miner Tops $500 Million in Ethereum Bitcoin miner BitMine saw its stock price briefly surge Monday after acquiring more Ethereum for its treasury. By Decrypt 2025-07-14
Metaplanet CEO joins investment in Korean company to boost Asia crypto treasuries !Metaplanet CEO joins investment in Korean company to boost Asia crypto … By Cointelegraph 2025-07-14
XRP Is Surging Again, Nearing All-Time High: Here's Why Favorable regulatory tailwinds and XRPs potential usefulness have impressed investors, analysts said. By Decrypt 2025-07-14
Solana catches up to competitors as tokenized assets soar 140% in 2025 !Solana catches up to competitors as tokenized assets soar 140 in 2025imagesnewssolana-catches-up-to-competitors-as-tokenized-asse2106bf97b636.jpg … By Cointelegraph 2025-07-14
Bitcoin hits new highs, gains stability and scale in its institutional era — Will it last? !Bitcoin hits new highs, gains stability and scale in its institutional era Will it … By Cointelegraph 2025-07-14
Coinbase seeks public records from Oregon gov’t on crypto ‘flip-flop’ !Coinbase seeks public records from Oregon govt on crypto flip-flopimagesnewscoinbase-seeks-public-records-from-oregon-govt-on-14d663529d84.jpg Known … By Cointelegraph 2025-07-14
Bitcoin charts, market cycle history hint at 15% short-term push to $138K !Bitcoin charts, market cycle history hint at 15 short-term push to 138Kimagesnewsbitcoin-charts-market-cycle-history-hint-at-15-sho0d8551441e7d.jpg … By Cointelegraph 2025-07-14
Kazakhstan wealth fund, gold, FX reserves to be invested in crypto — Report !Kazakhstan wealth fund, gold, FX reserves to be invested in crypto … By Cointelegraph 2025-07-14
Unlucky Trader Accidentally Burns $58K in Pump.fun Solana Token—But He's Not Angry A blockchain researcher said that his partner and friends were shocked at how calm he was after losing 58,000 worth of PUMP. By Decrypt 2025-07-14
'Rogue Politicians' Using Crypto to Hide Proceeds of Corruption: Nigeria EFCC Chair EFCC chair Ola Olukoyede said at an African Union event that corrupt politicians in Nigeria are hiding their loot in cryptocurrencies. By Decrypt 2025-07-14
US Crypto Week kicks off with 'Dictator' stablecoin amendment on the table !US Crypto Week kicks off with Dictator stablecoin amendment on the tableimagesnewsus-crypto-week-kicks-off-with-dictator-stablecoin-da681868abe3.jpg … By Cointelegraph 2025-07-14
Redefining global trade infrastructure: TradeOS joins Cointelegraph Accelerator !Redefining global trade infrastructure TradeOS joins Cointelegraph … By Cointelegraph 2025-07-14
Bitcoin Is on a Historic Run: Can BTC Keep It Up? The 9 weekly surge in the price of Bitcoin comes off the heels of bullish chart signals, with momentum indicators flashing strong potential for more … By Decrypt 2025-07-14
Price predictions 7/14: SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE !Price predictions 714 SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPEimagesnewsprice-predictions-7-14-spx-dxy-btc-eth-xrp-bnb-solc8a60cca5310.jpg … By Cointelegraph 2025-07-14
OKX joins Paxos’ USDG network as stablecoin push intensifies !OKX joins Paxos USDG network as stablecoin push intensifiesimagesnewsokx-joins-paxos-usdg-network-as-stablecoin-push-in16df34074b77.jpg Launched in … By Cointelegraph 2025-07-14
Crypto ETF Investors Want 'Ethereum Over Bitcoin' Amid Surging Demand: CoinShares Ethereums price surpassed 3,000 for the first time in five months last week. By Decrypt 2025-07-14
Crypto market cap hits $3.8T all-time high, may soon surpass UK’s GDP !Crypto market cap hits 3.8T all-time high, may soon surpass UKs GDPimagesnewscrypto-market-cap-hits-3-8t-all-time-high-may-soone65f16ca61a2.jpg If … By Cointelegraph 2025-07-14
Strategy Resumes Bitcoin Buys, Boosting Holdings to Over $72 Billion in BTC Other treasuries also added BTC as the asset set multiple record highs. By Decrypt 2025-07-14
BTC HITS $123K, PUMP LAUNCHES AT $5.5BN, SUI SOARS BTC pumps to new ATHs, dominance still at 65. Highest short liquidation in 4 years on July 10. SUI leads L1s as TVL hits ATH. Sharplink buys 49m ETH, … By Decrypt 2025-07-14
Binance Reveals Bonding Curve Feature—But It's Not Like Solana’s Pump.fun Users will be required to apply in order to launch a token via Binances new token generation event model, a spokesperson confirmed. By Decrypt 2025-07-14
China’s Stablecoin Studies Hint at 'Tiered' But Fractured Approach A closed-door meeting by Shanghai regulators hints at how the country is experimenting with stablecoins and digital assets. By Decrypt 2025-07-14
How one Nasdaq firm raised $51.5M in 72 Hours, just to buy Bitcoin !How one Nasdaq firm raised 51.5M in 72 Hours, just to buy Bitcoinimagesnewshow-one-nasdaq-firm-raised-51-5m-in-72-hours-just-f97b1a954532.jpg … By Cointelegraph 2025-07-14
'Don't get trapped!' Bitcoin price analysis sees dip with $118.8K in focus !Dont get trapped! Bitcoin price analysis sees dip with 118.8K in focusimagesnewsdon-t-get-trapped-bitcoin-price-analysis-sees-dip-d183e911349e.jpg … By Cointelegraph 2025-07-14
Money never sleeps, and Wall Street is waking up !Money never sleeps, and Wall Street is waking upimagesnewsmoney-never-sleeps-and-wall-street-is-waking-up0ceda78ceb80.jpg Wall Street 3.0 replaces … By Cointelegraph 2025-07-14
Grayscale Signals Plans to Go Public Amid Crypto IPO Revival The digital currency-focused asset manager filed preliminary paperwork that could lead to an IPO. By Decrypt 2025-07-14
Trump memecoin made $172M for crypto exchanges — Report !Trump memecoin made 172M for crypto exchanges Reportimagesnewstrump-memecoin-made-172m-for-crypto-exchanges-repocfc0c66a8134.jpg Crypto exchanges … By Cointelegraph 2025-07-14
It's Crypto Week: These are the key dates to watch !Its Crypto Week These are the key dates to watchimagesnewsit-s-crypto-week-these-are-the-key-dates-to-watcha59339a58c1c.jpg US House leaders have … By Cointelegraph 2025-07-14
Why crypto millionaires are moving to the UAE (these 5 reasons explain everything) !Why crypto millionaires are moving to the UAE these 5 reasons explain … By Cointelegraph 2025-07-14
Grayscale submits confidential IPO filing with SEC !Grayscale submits confidential IPO filing with SECimagesnewsgrayscale-submits-confidential-ipo-filing-with-secb3733e02173e.jpg Crypto-focused asset … By Cointelegraph 2025-07-14
Circle wants to launch America’s first digital currency bank: Here’s what it could offer !Circle wants to launch Americas first digital currency bank Heres what it could … By Cointelegraph 2025-07-14
Project X Aims to Give DeFi a Shot of Dopamine—Like 'Uniswap With Rizz' Project X seeks to open up Hyperliquids HyperEVM with a Uniswap-style automated market maker experienceand make DeFi more user-friendly too. By Decrypt 2025-07-14
Bitcoin, Ethereum Funds Reach Record High of $211 Billion Crypto ETFs hit record 3.7B weekly inflows as Bitcoin held above 121K, but analysts warn momentum could quickly reverse. By Decrypt 2025-07-14
Bitcoin 'shows no signs of fatigue' as it overtakes gold in gains for 2025 !Bitcoin shows no signs of fatigue as it overtakes gold in gains for 2025imagesnewsbitcoin-shows-no-signs-of-fatigue-as-it-overtakes-43a996549d1b.jpg … By Cointelegraph 2025-07-14
SharpLink Gaming buys $49M of ETH as price rebounds past $3K !SharpLink Gaming buys 49M of ETH as price rebounds past 3Kimagesnewssharplink-gaming-buys-49m-of-eth-as-price-rebounds5a71a8ecf0b3.jpg Now the … By Cointelegraph 2025-07-14
Biotech firm Sonnet to form $888M HYPE treasury !Biotech firm Sonnet to form 888M HYPE treasuryimagesnewsbiotech-firm-sonnet-to-form-888m-hype-treasuryc53cf883946c.jpg Biotech firm Sonnet is … By Cointelegraph 2025-07-14
Strategy bags another $472M in BTC as Bitcoin jumps to new highs !Strategy bags another 472M in BTC as Bitcoin jumps to new highsimagesnewsstrategy-bags-another-472m-in-btc-as-bitcoin-jumpsa1b739c421ec.jpg Michael … By Cointelegraph 2025-07-14
What you need to know about Roman Storm’s Tornado Cash trial !What you need to know about Roman Storms Tornado Cash trialimagesnewswhat-you-need-to-know-about-roman-storms-tornado-c819e286aea3c.jpg Tornado Cash … By Cointelegraph 2025-07-14
How high can Bitcoin price go? !How high can Bitcoin price go?imagesnewshow-high-can-bitcoin-price-go3cc1d574c8b8.jpg Is Bitcoin headed for a correction after 130K or 200K? Various … By Cointelegraph 2025-07-14
Altcoins XRP, SOL, DOGE Surge Following Bitcoin's New All-Time High Bitcoin hit a new all-time high on Monday, propelling altcoins including Sui, XRP, and DOGE to notable gains. By Decrypt 2025-07-14
Judge Tosses NFT Lawsuit Against Dolce & Gabbana USA The group pleading and shared branding werent enough to prove DG USA controlled or misled in the NFT project, said the judge. By Decrypt 2025-07-14
Metaplanet CEO Quietly Helps Acquire Asian Firms to Push Bitcoin Agenda South Korean regulators have approved a takeover of SGA Co. by investors tied to Metaplanet and Sora Ventures. By Decrypt 2025-07-14
Crypto funds post $3.7B inflows as Bitcoin soars to new highs !Crypto funds post 3.7B inflows as Bitcoin soars to new highsimagesnewscrypto-funds-post-3-7b-inflows-as-bitcoin-soars-to401d22178e61.jpg Crypto ETPs … By Cointelegraph 2025-07-14
Bhutan gov’t moves $74M in BTC to Binance as price hits new highs !Bhutan govt moves 74M in BTC to Binance as price hits new highsimagesnewsbhutan-govt-moves-74m-in-btc-to-binance-as-price-had152e43f64c.jpg Bhutans … By Cointelegraph 2025-07-14
Bitcoin flips Amazon’s $2.3T market cap to become 5th global asset !Bitcoin flips Amazons 2.3T market cap to become 5th global assetimagesnewsbitcoin-flips-amazons-2-3t-market-cap-to-become-5t36fbc7ddadc9.jpg Bitcoin … By Cointelegraph 2025-07-14
XRP price ‘highly rare’ setup eyes 60% gain past $3, veteran trader says !XRP price highly rare setup eyes 60 gain past 3, veteran trader saysimagesnewsxrp-price-highly-rare-setup-eyes-60-gain-past-3-vea7c00f6502db.jpg XRP … By Cointelegraph 2025-07-14
BTC price in 'crisis mode' at $123K: 5 things to know in Bitcoin this week !BTC price in crisis mode at 123K 5 things to know in Bitcoin this weekimagesnewsbtc-price-in-crisis-mode-at-123k-5-things-to-know-265cd0d7e8b7.jpg … By Cointelegraph 2025-07-14
Tax season vs tax year: What’s the difference? !Tax season vs tax year Whats the difference?imagesnewstax-season-vs-tax-year-whats-the-differencefd95006a7651.jpg Understanding the distinction … By Cointelegraph 2025-07-14
Tornado Cash’s Roman Storm makes urgent plea for $500K as trial looms !Tornado Cashs Roman Storm makes urgent plea for 500K as trial loomsimagesnewstornado-cashs-roman-storm-makes-urgent-plea-for-504725612f84e7.jpg … By Cointelegraph 2025-07-14
El Salvador’s Bitcoin Stash Tops $760M as BTC Breaks Above $122K Sovereign Bitcoin reserves may become a long-term strategy for nations as El Salvadors gains show multi-year value, Decrypt was told. By Decrypt 2025-07-14
‘100-bagger’ — Ethereum could hit $1.5M over time: EMJ Capital !100-bagger Ethereum could hit 1.5M over time EMJ Capitalimagesnews100-bagger-ethereum-could-hit-1-5m-over-time-emj-c32d9a0f83f01.jpg EMJ Capital … By Cointelegraph 2025-07-14
Jack Dorsey’s new app tracks how much grass you’re touching !Jack Dorseys new app tracks how much grass youre touchingimagesnewsjack-dorseys-new-app-tracks-how-much-grass-youre-t97a2e5aa359b.jpg Sun Day is the … By Cointelegraph 2025-07-14
Controversial Bitcoin upgrade BIP-119 may be decided by end of year !Controversial Bitcoin upgrade BIP-119 may be decided by end of yearimagesnewscontroversial-bitcoin-upgrade-bip-119-may-be-decida07b500267d9.jpg If … By Cointelegraph 2025-07-14
Bitcoin is rallying on US deficit concerns, not hype: Analyst !Bitcoin is rallying on US deficit concerns, not hype Analystimagesnewsbitcoin-is-rallying-on-us-deficit-concerns-not-hypea7c088f44eb.jpg Bitcoin has … By Cointelegraph 2025-07-14
Tornado Cash's Roman Storm Alleges DOJ Botched Key Telegram Evidence Storms legal counsel alleges prosecutors misattributed a journalists message and failed to disclose the mistake immediately. By Decrypt 2025-07-14
SharpLink Buys $48M in Ethereum, Lifts Stock Higher in Overnight Trade The Nasdaq-listed gaming firm turned strategic reserve, has made consecutive eight-figure buys of Ethereum. By Decrypt 2025-07-14
NFT lawsuit against Dolce & Gabbana in doubt as US arm cleared !NFT lawsuit against Dolce Gabbana in doubt as US arm clearedimagesnewsnft-lawsuit-against-dolce-gabbana-in-doubt-as-us-a55e6ac79d2ec.jpg A US … By Cointelegraph 2025-07-14
xAI blames code for Grok’s anti-Semitic Hitler posts !xAI blames code for Groks anti-Semitic Hitler postsimagesnewsxai-blames-code-for-groks-anti-semitic-hitler-post75afa11effcb.jpg xAI blamed an … By Cointelegraph 2025-07-14
US Economy in a 'Goldilocks-Like Equilibrium' as Bitcoin Blasts Past $121K Bitcoins record-breaking rally is being fueled by tariff-driven trade flows, high Treasury payouts, and a broader shift toward risk assets. By Decrypt 2025-07-14
Satoshi Nakamoto is now the 11th richest person in the world !Satoshi Nakamoto is now the 11th richest person in the worldimagesnewssatoshi-nakamoto-is-now-the-11th-richest-person-ine7779e96d3ea.jpg Bitcoin … By Cointelegraph 2025-07-14
Bitcoin taps new all-time high at $120K on Coinbase !Bitcoin taps new all-time high at 120K on Coinbaseimagesnewsbitcoin-taps-new-all-time-high-at-120k-on-coinbased82c83dfb413.jpg Bitcoin reached a new … By Cointelegraph 2025-07-14
Bank of England governor warns against private stablecoin issuance !Bank of England governor warns against private stablecoin issuanceimagesnewsbank-of-england-governor-warns-against-private-stacb80ef52335a.jpg Bank … By Cointelegraph 2025-07-13
Real-world asset tokens are the new ETFs — CoinFund president !Real-world asset tokens are the new ETFs CoinFund presidentimagesnewsreal-world-asset-tokens-are-the-new-etfs-coinfund-c835823532fa.jpg Tokens are … By Cointelegraph 2025-07-13
This Week in Crypto Games: 'Off the Grid' Token Hits Solana, More Games Shut Down Off the Grids GUN token has expanded from Avalanche to Solana, while the list of crypto games shut down in 2025 only grew last week. By Decrypt 2025-07-13
The Cryptographic Fix for US Elections Is Still Sitting on the Shelf A former voting tech auditor claims that voting machines still lack key security fixes flagged in 2006, leaving U.S. elections vulnerable. By Decrypt 2025-07-13
Michael Saylor signals Bitcoin buy after one-week hiatus !Michael Saylor signals Bitcoin buy after one-week hiatusimagesnewsmichael-saylor-signals-bitcoin-buy-after-one-week-d1a505c2d772.jpg Strategy … By Cointelegraph 2025-07-13
The Best Bitcoin and Crypto Credit Cards in 2025 Credit card users are no longer limited to points and cashback on purchasesnow there are crypto rewards, too. By Decrypt 2025-07-13
Bitcoin hits new all-time high above $119K as trader eyes 7-week uptrend !Bitcoin hits new all-time high above 119K as trader eyes 7-week uptrendimagesnewsbitcoin-hits-new-all-time-high-above-119k-as-trade05a0efe75de7.jpg … By Cointelegraph 2025-07-13
RWAs build mirrors where they need building blocks !RWAs build mirrors where they need building blocksimagesnewsrwas-build-mirrors-where-they-need-building-blocks441a58f76b54.jpg Most RWAs remain … By Cointelegraph 2025-07-13
5 of the Weirdest Bitcoin, Dogecoin and Ethereum Treasury Pivots From noodle giants to love hotel operators and cannabis sellers, these five publicly traded companies made unexpected bets on Bitcoin and other … By Decrypt 2025-07-13
CZ shares rumors linking Coinbase to Bloomberg’s Trump stablecoin report !CZ shares rumors linking Coinbase to Bloombergs Trump stablecoin reportimagesnewscz-shares-rumors-linking-coinbase-to-bloombergs-tr7c1b241a1f92.jpg … By Cointelegraph 2025-07-13
Collapsed crypto firm Ziglu faces $2.7M deficit amid special administration !Collapsed crypto firm Ziglu faces 2.7M deficit amid special … By Cointelegraph 2025-07-13
Czech central bank adds Coinbase to portfolio, boosts Palantir holdings !Czech central bank adds Coinbase to portfolio, boosts Palantir holdingsimagesnewsczech-central-bank-adds-coinbase-to-portfolio-boos30b62ceba9ed.jpg … By Cointelegraph 2025-07-13
Bitcoin headed for 36 more public companies by year-end: Blockware !Bitcoin headed for 36 more public companies by year-end Blockwareimagesnewsbitcoin-headed-for-36-more-public-companies-by-yeac250d44578c8.jpg The … By Cointelegraph 2025-07-13
Bitcoin retail interest ‘almost nowhere to be found’ as BTC taps highs !Bitcoin retail interest almost nowhere to be found as BTC taps highsimagesnewsbitcoin-retail-interest-almost-nowhere-to-be-found94093f9834a2.jpg … By Cointelegraph 2025-07-13
Schiff says sell Bitcoin for silver as $258K target looms: Hodler’s Digest, July 6 – 12 !Schiff says sell Bitcoin for silver as 258K target looms Hodlers Digest, July 6 … By Cointelegraph 2025-07-13
High-leverage trader James Wynn deactivates X account !High-leverage trader James Wynn deactivates X accountimagesnewshigh-leverage-trader-james-wynn-deactivates-x-acco4d4192af5f87.jpg High-risk trader … By Cointelegraph 2025-07-12
Bitcoin's four-year market cycle isn't dead — Xapo Bank CEO !Bitcoins four-year market cycle isnt dead Xapo Bank CEOimagesnewsbitcoin-s-four-year-market-cycle-isn-t-dead-xapo-b88691edaad30.jpg Seamus Rocca … By Cointelegraph 2025-07-12
Why Are So Many Crypto Games Shutting Down? Experts Weigh In Experts say launching tokens for crypto games applies unnecessary pressure on developmentand makes failures even more public. By Decrypt 2025-07-12
Animoca Brands partners with DDC Enterprise to put BTC treasury to work !Animoca Brands partners with DDC Enterprise to put BTC treasury to workimagesnewsanimoca-brands-partners-with-ddc-enterprise-to-putaba9bf37d1d0.jpg … By Cointelegraph 2025-07-12
Pump.fun ICO raises $500M, sells out within minutes !Pump.fun ICO raises 500M, sells out within minutesimagesnewspump-fun-ico-raises-500m-sells-out-within-minutesa0af7f12d16c.jpg Venture capitalists … By Cointelegraph 2025-07-12
As Bitcoin Matures, Volatility Drops—So Expect Slower Climbs, Say Experts Bitcoin to the moon? Not so fast, experts say, as the asset has matured and is now being used by traders for more sophisticated bets. By Decrypt 2025-07-12
Grok 4 Basic Review: $30 a Month for This? Elon Musk's AI Now Thinks Like Him While Elon Musks 300 Heavy model puts up record-breaking benchmark scores, the basic Grok 4 struggles to keep up with competitors. By Decrypt 2025-07-12
Telegram is not a neobank — it’s the platform where the next ones are born !Telegram is not a neobank its the platform where the next ones are bornimagesnewstelegram-is-not-a-neobank-its-the-platform-where-t7edc2b1819d6.jpg … By Cointelegraph 2025-07-12
How a teen stole $243M in Bitcoin and revealed his identity on livestream !How a teen stole 243M in Bitcoin and revealed his identity on livestreamimagesnewshow-a-teen-stole-243m-in-bitcoin-and-revealed-his-0d08af07836e.jpg … By Cointelegraph 2025-07-12
The SEC Chair Who Sued Ripple Is Now Prosecuting Roman Storm Jay Clayton, President Trumps onetime SEC head, is now top prosecutor at the DOJ office set to take Roman Storm to trial on Monday. By Decrypt 2025-07-12
Asia’s tokenization boom is shifting capital away from the West: Expert !Asias tokenization boom is shifting capital away from the West Expertimagesnewsasias-tokenization-boom-is-shifting-capital-away-f58852f72ce03.jpg … By Cointelegraph 2025-07-12
Binance’s CZ threatens to sue Bloomberg over Trump stablecoin report !Binances CZ threatens to sue Bloomberg over Trump stablecoin reportimagesnewsbinances-cz-threatens-to-sue-bloomberg-over-trump-da326b1b830d.jpg … By Cointelegraph 2025-07-12
BlockFi bankruptcy administrator and DOJ agree to dismiss $35M lawsuit !BlockFi bankruptcy administrator and DOJ agree to dismiss 35M lawsuitimagesnewsblockfi-bankruptcy-administrator-and-doj-agree-to-1e30b33bc067.jpg … By Cointelegraph 2025-07-12
US Bitcoin ETFs record first back-to-back $1B inflows !US Bitcoin ETFs record first back-to-back 1B inflowsimagesnewsus-bitcoin-etfs-record-first-back-to-back-1b-inflob88e24ca00e1.jpg US-based spot … By Cointelegraph 2025-07-12
Altcoins are rocketing, Bitcoin dominance hasn’t ‘even sneezed’: Analyst !Altcoins are rocketing, Bitcoin dominance hasnt even sneezed Analystimagesnewsaltcoins-are-rocketing-bitcoin-dominance-hasnt-eve2cf51f4da05b.jpg … By Cointelegraph 2025-07-12
XRP’s 'very positive sign’ — Whales soar to new highs as price jumps 10% !XRPs very positive sign Whales soar to new highs as price jumps 10imagesnewsxrps-very-positive-sign-whales-soar-to-new-highs-adbb498bdfb1b.jpg … By Cointelegraph 2025-07-12
Bitcoin Christmas rally to $200K or $300K possible based on ‘power law’ model !Bitcoin Christmas rally to 200K or 300K possible based on power law … By Cointelegraph 2025-07-11
House Democrats Struggle to Approach 'Crypto Week' With Unified Front Some Democrats are pledging to punish other party members who support what they see as Trumps crypto corruption. Leadership has largely stayed out of … By Decrypt 2025-07-11
Bitzlato co-founder requests US pardon after guilty plea — Report !Bitzlato co-founder requests US pardon after guilty plea Reportimagesnewsbitzlato-co-founder-requests-us-pardon-after-guilt150b4d49cab8.jpg US … By Cointelegraph 2025-07-11
Coinbase, Strategy, Other Bitcoin and Crypto Stocks Soar in Record-Setting Week Crypto-focused companies benefited from the surge in crypto markets this week. By Decrypt 2025-07-11
Tether to End USDT Redemptions on Bitcoin Cash, Algorand and Beyond Stablecoin issuer Tether is ending support for USDT on five legacy blockchains after previously halting minting on those networks. By Decrypt 2025-07-11
France opens criminal investigation into X for alleged algorithmic manipulation !France opens criminal investigation into X for alleged algorithmic … By Cointelegraph 2025-07-11
US Democrats push back on digital asset bills with ‘anti-crypto corruption week’ !US Democrats push back on digital asset bills with anti-crypto corruption … By Cointelegraph 2025-07-11
Solana Treasury Firm Upexi Raises $200 Million to Boost SOL Stash Publicly traded Upexi is poised to boast the largest Solana treasury stash once its latest funding round is completed. By Decrypt 2025-07-11
Public Keys: CoreWeave Fusion Dance, $1 Billion Day for Bitcoin ETFs and Strategy's Bye Week Core Scientific and CoreWeave announce a massive 9B merger while Bitcoin ETFs see their second-biggest day ever with 1.17B in inflows. By Decrypt 2025-07-11
Crypto Biz: Bitcoin VC surges, Robinhood faces tokenization scrutiny, CZ debunks Golden Visa hype !Crypto Biz Bitcoin VC surges, Robinhood faces tokenization scrutiny, CZ debunks Golden Visa … By Cointelegraph 2025-07-11
Is the crypto market entering a new supercycle? Here are 5 ways to know !Is the crypto market entering a new supercycle? Here are 5 ways to knowimagesnewsis-the-crypto-market-entering-a-new-supercycle-her5e24d64f265f.jpg … By Cointelegraph 2025-07-11
Tether to discontinue USDT on five blockchains to 'refocus resources' !Tether to discontinue USDT on five blockchains to refocus resourcesimagesnewstether-to-discontinue-usdt-on-five-blockchains-to-dc52a66ff324.jpg The … By Cointelegraph 2025-07-11
Grok 4 Predicts Dodgers for World Series Win—But Other AIs Aren't So Sure Elon Musks new model crunched Polymarket odds and picked the Dodgers, but ChatGPT and DeepSeek favor the Tigers as a better value for bettors. By Decrypt 2025-07-11
How to day trade crypto using ChatGPT and Grok !How to day trade crypto using ChatGPT and Grokimagesnewshow-to-day-trade-crypto-using-chatgpt-and-grok3fde2e0ad9a1.jpg AI tools like Grok and … By Cointelegraph 2025-07-11
GMX Hacker Goes White-Hat, Returns $40 Million—Sends Rest to Tornado Cash After returning funds to GMX, it appeared a would-be hacker sent 5 million in Ethereum to the coin mixer. By Decrypt 2025-07-11
Despite record high, S&P 500 is down in Bitcoin terms !Despite record high, SP 500 is down in Bitcoin termsimagesnewsdespite-record-high-s-p-500-is-down-in-bitcoin-terf17142aaad03.jpg The SP 500 Index … By Cointelegraph 2025-07-11
SEC's Halt of ETF Holding XRP and Solana Has Investors 'Suffering Harm', Grayscale Says Grayscale said in a letter on Tuesday that it may take legal action if the SEC continues to hold up the debut of its multi-token fund on NYSE Arca. By Decrypt 2025-07-11
LetsBonk stuns Solana memecoin launchpad rankings: Finance Redefined !LetsBonk stuns Solana memecoin launchpad rankings Finance Redefinedimagesnewsletsbonk-stuns-solana-memecoin-launchpad-rankings-1102f5af41e8.jpg … By Cointelegraph 2025-07-11
Bitcoin $120K expectations add fuel to ETH, HYPE, UNI and SEI !Bitcoin 120K expectations add fuel to ETH, HYPE, UNI and SEIimagesnewsbitcoin-120k-expectations-add-fuel-to-eth-hype-uniecc6342a877d.jpg ETH, HYPE, … By Cointelegraph 2025-07-11
Grayscale calls out SEC delay of Digital Large Cap Fund ETF listing !Grayscale calls out SEC delay of Digital Large Cap Fund ETF listingimagesnewsgrayscale-calls-out-sec-delay-of-digital-large-cap6fa2741e31df.jpg … By Cointelegraph 2025-07-11
XRP Price Spike Outpaces Bitcoin as Open Interest Nears 6-Month High Bitcoin keeps pushing to new highs, but the Ripple-linked XRP has actually surged more over the past day while open interest soars. By Decrypt 2025-07-11
Binance helped create World Liberty Financial stablecoin — Report !Binance helped create World Liberty Financial stablecoin Reportimagesnewsbinance-helped-create-world-liberty-financial-stab27f6bc50e231.jpg A … By Cointelegraph 2025-07-11
SharpLink Shares Rise After Firm Buys $30 Million in ETH From Ethereum Foundation The Ethereum treasury company is only second to the Ethereum Foundation in the size of its holdings. By Decrypt 2025-07-11
Dogecoin Barks Up Huge Gains as Meme Coin Traders Await Pump.fun Token Sale Meme coins, led by Dogecoin, are jumping higher Friday as Bitcoin hits new highsand the Pump.fun Solana token sale is only hours away. By Decrypt 2025-07-11
BTC & ETH SOAR, S&P HITS ATH, MOG LEADS MEMES BTC hits ATH, ETH breaks 3k on huge ETF inflows. One of biggest BTC short liquidation event in years. China may be reassessing crypto stance. IBIT … By Decrypt 2025-07-11
HIVE Digital stock soars on BTC mining, revenue milestones !HIVE Digital stock soars on BTC mining, revenue milestonesimagesnewshive-digital-stock-soars-on-btc-mining-revenue-mil6ca027ea6e02.jpg The … By Cointelegraph 2025-07-11
Will Pump.fun's Solana Token Pump After Launch? Experts Weigh In At its earliest, Pump.funs token will become tradable on Monday and traders are starting to question whether itll pump or dump. By Decrypt 2025-07-11
Dubai won the real estate tokenization play !Dubai won the real estate tokenization playimagesnewsdubai-won-the-real-estate-tokenization-playfbd09d4e1454.jpg Dubai is pioneering real estate … By Cointelegraph 2025-07-11
How crypto scammers used dating apps to steal $36.9M and launder it to Cambodia !How crypto scammers used dating apps to steal 36.9M and launder it to … By Cointelegraph 2025-07-11
TRON strengthens its role in stablecoin settlements: Mid-year report !TRON strengthens its role in stablecoin settlements Mid-year reportimagesnewstron-strengthens-its-role-in-stablecoin-settlement9b7c16ff9ba3.jpg … By Cointelegraph 2025-07-11
‘Crypto Week’ approaches: Will these three pro-crypto bills pass? !Crypto Week approaches Will these three pro-crypto bills pass?imagesnewscrypto-week-approaches-will-these-three-pro-crypto85629eb74d8b.jpg Crypto … By Cointelegraph 2025-07-11
SharpLink buys 10,000 ETH from Ethereum Foundation as Ether reclaims $3K !SharpLink buys 10,000 ETH from Ethereum Foundation as Ether reclaims 3Kimagesnewssharplink-buys-10000-eth-from-ethereum-foundation-ff1607972402.jpg … By Cointelegraph 2025-07-11
US Congress prepares for ‘Crypto Week’ as industry urges lawmakers to act !US Congress prepares for Crypto Week as industry urges lawmakers to actimagesnewsus-congress-prepares-for-crypto-week-as-industry-u190e6ac60521.jpg … By Cointelegraph 2025-07-11
Peter Schiff says sell Bitcoin for silver as BTC smashes new highs !Peter Schiff says sell Bitcoin for silver as BTC smashes new highsimagesnewspeter-schiff-says-sell-bitcoin-for-silver-as-btc-s02651af3f227.jpg … By Cointelegraph 2025-07-11
Bitcoin ETFs Post Second-Biggest Day Ever: Why It Matters BlackRocks IBIT led Thursdays ETF inflows with 448.5 million, as capital consolidated into top issuers despite outflows from GBTC. By Decrypt 2025-07-11
Ethereum Foundation roadmap targets zkEVM in mainnet within a year !Ethereum Foundation roadmap targets zkEVM in mainnet within a yearimagesnewsethereum-foundation-roadmap-targets-zkevm-in-mainn58adeafe16ed.jpg The … By Cointelegraph 2025-07-11
Shanghai officials warm to stablecoins despite China crypto ban: Report !Shanghai officials warm to stablecoins despite China crypto ban Reportimagesnewsshanghai-officials-warm-to-stablecoins-despite-chiadfcb71f7e05.jpg … By Cointelegraph 2025-07-11
Bitcoin Price Reaches Pivotal Moment—Is $120K Next? Bitcoin hit a new all-time high above 118,000 as institutions drove the rallywhile analysts predicted a 120K target by month-end. By Decrypt 2025-07-11
$1.14B in Crypto Shorts Rekt as Ethereum Tops $3K For First Time Since February Ethereum topped 3,000 for the first time since February, following the largest single day for ETH exchange-traded fund inflows. By Decrypt 2025-07-11
Hacker returns stolen funds from $40M GMX exploit !Hacker returns stolen funds from 40M GMX exploitimagesnewshacker-returns-stolen-funds-from-40m-gmx-exploit54a4f7e8fbd9.jpg The attacker behind the … By Cointelegraph 2025-07-11
Malicious Pull Request Inserted Into Ethereum Code Extension: Research Cybersecurity firm ReversingLabs uncovered two lines of malicious code in an update forETHCode, an open source suite of tools. By Decrypt 2025-07-11
Malta regulator: No MiCA licenses at risk after EU review !Malta regulator No MiCA licenses at risk after EU reviewimagesnewsmalta-regulator-no-mica-licenses-at-risk-after-eu-ce0b4c623dc6.jpg Malta has … By Cointelegraph 2025-07-11
Thou shalt not shill: Fake ‘Vatican Chamber’ token presale exposed !Thou shalt not shill Fake Vatican Chamber token presale exposedimagesnewsthou-shalt-not-shill-fake-vatican-chamber-token-pr04652c3071db.jpg The … By Cointelegraph 2025-07-11
Can you earn passive income running a Lightning node? !Can you earn passive income running a Lightning node?imagesnewscan-you-earn-passive-income-running-a-lightning-noc259bac82429.jpg Running a … By Cointelegraph 2025-07-11
Bitcoin, Ether ETFs clock second-biggest day of inflows on record !Bitcoin, Ether ETFs clock second-biggest day of inflows on recordimagesnewsbitcoin-ether-etfs-clock-second-biggest-day-of-inf337e274d1e2d.jpg … By Cointelegraph 2025-07-11
Tasmanian police find top 15 crypto ATM users are scam victims !Tasmanian police find top 15 crypto ATM users are scam victimsimagesnewstasmanian-police-find-top-15-crypto-atm-users-are-e0bce3471583.jpg Tasmanian … By Cointelegraph 2025-07-11
Florida AG Investigates Robinhood Over Crypto Pricing Claims Floridas AG said Robinhoods payment-for-order-flow model may mislead users by hiding true crypto costs behind marketing claims. By Decrypt 2025-07-11
LIBRA token creator fights class suit, citing lack of jurisdiction !LIBRA token creator fights class suit, citing lack of jurisdictionimagesnewslibra-token-creator-fights-class-suit-citing-lack-aae6e057ec16.jpg … By Cointelegraph 2025-07-11
OpenAI faces IRS complaint over alleged tax violations !OpenAI faces IRS complaint over alleged tax violationsimagesnewsopenai-faces-irs-complaint-over-alleged-tax-violatcd836d809687.jpg The Midas Project … By Cointelegraph 2025-07-11
What Crypto Derivatives Say About Bitcoin's Record Price Despite Bitcoins push to a new all-time high, the price outlook remains cautiously optimistic, Decrypt was told. By Decrypt 2025-07-11
‘Bears in disbelief’ — $1B in crypto shorts wiped as Bitcoin pumps !Bears in disbelief 1B in crypto shorts wiped as Bitcoin pumpsimagesnewsbears-in-disbelief-1b-in-crypto-shorts-wiped-as-bi7b46fa3fb2a0.jpg … By Cointelegraph 2025-07-11
SIM Swapper Who Stole $20 Million in Crypto Resentenced to 12 Years in Prison Truglias original 18-month term was dramatically increased after he failed to pay restitution to crypto investor Michael Terpin. By Decrypt 2025-07-11
Investors are balking at ‘excessive’ Bitcoin miner exec pay: VanEck !Investors are balking at excessive Bitcoin miner exec pay VanEckimagesnewsinvestors-are-balking-at-excessive-bitcoin-miner-e8e66ab7fcd44.jpg Bitcoin … By Cointelegraph 2025-07-11
Pump.fun buys Kolscan in first acquisition, eyes gamified trading !Pump.fun buys Kolscan in first acquisition, eyes gamified tradingimagesnewspump-fun-buys-kolscan-in-first-acquisition-eyes-ga171772448e04.jpg … By Cointelegraph 2025-07-11
If You Bought Ethereum When Eric Trump Said So, You’re Finally in the Green Ethereum plunged as much as 37 after the presidents son called it a buy in February. Five months later, it has slowly clawed its way back. By Decrypt 2025-07-11
Florida probes Robinhood’s crypto trading promotion !Florida probes Robinhoods crypto trading promotionimagesnewsflorida-probes-robinhoods-crypto-trading-promotion7798e3a492ef.jpg Lucas Moskowitz, … By Cointelegraph 2025-07-11
Bitcoin Stablecoin Network Plasma Sets XPL Token Sale After Attracting $1 Billion in Deposits Plasma will feature several unreleased stablecoins upon its late summer mainnet launch, although it wouldnt confirm who would issue them. By Decrypt 2025-07-10
Agora Raises $50 Million to Power Next Wave of Stablecoins Agora, which debuted its platform last year, said the funds will help businesses introduce and manage their own branded stablecoins. By Decrypt 2025-07-10
SUI bullish chart pattern confirmation sets breakout target at $3.89 !SUI bullish chart pattern confirmation sets breakout target at 3.89imagesnewssui-bullish-chart-pattern-confirmation-sets-breako5912d6c68e91.jpg SUI … By Cointelegraph 2025-07-10
Ex-Bitfury Executive Receives Senate Nod to Head Banking Regulator Jonathan Gould, a former chief legal officer at blockchain company Bitfury, was confirmed by the U.S. Senate to lead the Office of the Comptroller of … By Decrypt 2025-07-10
US Senate confirms ex-Bitfury exec to lead OCC banking regulator !US Senate confirms ex-Bitfury exec to lead OCC banking regulatorimagesnewsus-senate-confirms-ex-bitfury-exec-to-lead-occ-band2218684bd39.jpg … By Cointelegraph 2025-07-10
Crypto scammer's sentence bumped to 12 years from 18 months for welshing on debt !Crypto scammers sentence bumped to 12 years from 18 months for welshing on … By Cointelegraph 2025-07-10
ETH maxis scream for $3K, but data shows pro Ether traders cautiously positioned !ETH maxis scream for 3K, but data shows pro Ether traders cautiously … By Cointelegraph 2025-07-10
Bitcoin Shorts Get Rekt as BTC Tops $116K for First Time The price of Bitcoin just soared to another all-time high, and hundreds of millions of dollars worth of shorts have been liquidated. By Decrypt 2025-07-10
Why I won't invest in companies that ignore AI — Kevin O'Leary !Why I wont invest in companies that ignore AI Kevin OLearyimagesnewswhy-i-won-t-invest-in-companies-that-ignore-ai-keva6dc76ba23b2.jpg Ignoring the … By Cointelegraph 2025-07-10
Bitcoin price expected to accelerate if daily close above $113K is secured !Bitcoin price expected to accelerate if daily close above 113K is … By Cointelegraph 2025-07-10
Roman Storm’s lawyers signal continuance if court allows hacker’s testimony !Roman Storms lawyers signal continuance if court allows hackers … By Cointelegraph 2025-07-10
Myriad Moves: Will Bitcoin Stay Hot? This Week's Buzziest Prediction Markets This weeks top prediction markets on Myriad cover Bitcoin recent price surge, PENGUs ETF approval chances, Wimbledon, and more. By Decrypt 2025-07-10
Threat actors using 'elaborate social engineering scheme' to target crypto users — Report !Threat actors using elaborate social engineering scheme to target crypto users … By Cointelegraph 2025-07-10
Securities On-Chain? There's Only One True Way, Says BlackRock-Backed Firm's CEO Theres only one way to truly represent securities on-chain, said Securitize CEO Carlos Domingo, and thats through native tokenization. By Decrypt 2025-07-10
Coinbase partners with Perplexity AI for real-time crypto prices !Coinbase partners with Perplexity AI for real-time crypto pricesimagesnewscoinbase-partners-with-perplexity-ai-for-real-time31494184a4f3.jpg … By Cointelegraph 2025-07-10
Bitcoin price likely to hit $130K before serious profit taking kicks in !Bitcoin price likely to hit 130K before serious profit taking kicks inimagesnewsbitcoin-price-likely-to-hit-130k-before-serious-prcff9722a9cee.jpg … By Cointelegraph 2025-07-10
Bitcoin Breaks Into New Price Territory: What Happens Next? Bitcoin has broken out. Can it maintain its bullish momentum? Lets take a look at the charts. By Decrypt 2025-07-10
IRS Formally Removes Anti-DeFi Broker Rule From Tax Code A resolution repealing the rule was signed into law by President Trump in April, after passing both the House and Senate with bipartisan support. By Decrypt 2025-07-10
ETH news update: Ether treasury purchases could trigger rally to $3K !ETH news update Ether treasury purchases could trigger rally to 3Kimagesnewseth-news-update-ether-treasury-purchases-could-tric291192f5f7c.jpg Ether … By Cointelegraph 2025-07-10
Coinbase CEO Says Crypto Integration Could Be '10x Unlock' for AI Coinbase has teamed with Perplexity AI to bring real-time crypto data into AI-powered searchand Brian Armstrong sees major benefits. By Decrypt 2025-07-10
10 public companies that quietly turned their balance sheets into Bitcoin treasuries !10 public companies that quietly turned their balance sheets into Bitcoin … By Cointelegraph 2025-07-10
PENGU, Dogecoin Lead Meme Coin Spike as Bitcoin Sets Another Record Meme coins are blasting off again after Bitcoin topped 113,000, with heavyweights like Dogecoin, PENGU, and Fartcoin leading the charge. By Decrypt 2025-07-10
Bitcoin hits $113.8K all-time high as liquidity influx backs BTC price discovery !Bitcoin hits 113.8K all-time high as liquidity influx backs BTC price … By Cointelegraph 2025-07-10
BIT Mining Stock Soars After Bitcoin, Dogecoin Miner Reveals $300 Million Solana Pivot The U.S. miner also wants to convert its current holdings to SOL. By Decrypt 2025-07-10
Bitcoin Hits Another All-Time High Price After Trump Renews Rate Cut Push Bitcoin is flying again, setting a fresh record above 112,000 after President Trump urged the Fed to again lower interest rates. By Decrypt 2025-07-10
US lawmakers to discuss crypto tax policy amid push to pass three bills !US lawmakers to discuss crypto tax policy amid push to pass three billsimagesnewsus-lawmakers-to-discuss-crypto-tax-policy-amid-pus984f9e0b088b.jpg … By Cointelegraph 2025-07-10
What Is Tokenization? We explore what tokenization is, how it works, and how its revolutionizing the way assets can be issued, managed, and traded. By Decrypt 2025-07-10
Japan’s Gates to tokenize $75M in Tokyo real estate on Oasys blockchain !Japans Gates to tokenize 75M in Tokyo real estate on Oasys blockchainimagesnewsjapans-gates-to-tokenize-75m-in-tokyo-real-estate-f4af2745a7f2.jpg … By Cointelegraph 2025-07-10
Bitcoin Treasury Company Rumble to Launch Crypto Wallet With MoonPay Publicly traded video sharing platform Rumble is launching its own crypto wallet after establishing a Bitcoin treasury. By Decrypt 2025-07-10
US sees stablecoins as key to preserving the dollar’s reserve status — Sygnum !US sees stablecoins as key to preserving the dollars reserve status … By Cointelegraph 2025-07-10
Myriad Protocol Launches With Multichain Expansion to Ethereum L2 Linea With key components being built on EigenCloud, Myriad Protocol is designed to power prediction markets everywhere, for everyone. By Decrypt 2025-07-10
BTC HITS ATH, PUMPFUN RELEASES TOKENOMICS, PENGU SOARS BTC hits new ATH, ETH leads majors. ETH heading to 10k Hayes. BTC overtakes Alphabet in market value. Whale fumbles 26m profit from ETH short. … By Decrypt 2025-07-10
India’s Bitcoin crossroads: Will it add BTC to national reserves? !Indias Bitcoin crossroads Will it add BTC to national reserves?imagesnewsindias-bitcoin-crossroads-will-it-add-btc-to-natio0ae0ba6b5db4.jpg As the … By Cointelegraph 2025-07-10
Trump’s crypto agenda favors elites, not the everyday user !Trumps crypto agenda favors elites, not the everyday userimagesnewstrumps-crypto-agenda-favors-elites-not-the-everydaf12b3de51fe7.jpg Donald Trumps … By Cointelegraph 2025-07-10
Bit Mining surges 350% on pivot to Solana, plans $300M token treasury !Bit Mining surges 350 on pivot to Solana, plans 300M token treasuryimagesnewsbit-mining-surges-350-on-pivot-to-solana-plans-30017a14d42c942.jpg Bit … By Cointelegraph 2025-07-10
Jack Ma-backed Ant Group eyes USDC stablecoin for own blockchain: Report !Jack Ma-backed Ant Group eyes USDC stablecoin for own blockchain Reportimagesnewsjack-ma-backed-ant-group-eyes-usdc-stablecoin-for-c4105e9b527a.jpg … By Cointelegraph 2025-07-10
Stablecoin startup Agora secures $50M investment led by Paradigm !Stablecoin startup Agora secures 50M investment led by Paradigmimagesnewsstablecoin-startup-agora-secures-50m-investment-le8c14b15e7a42.jpg Agora, … By Cointelegraph 2025-07-10
Is privacy crypto’s last stand? Industry experts on the legal battles ahead !Is privacy cryptos last stand? Industry experts on the legal battles … By Cointelegraph 2025-07-10
Malta’s MiCA licensing comes under scrutiny from EU regulator !Maltas MiCA licensing comes under scrutiny from EU regulatorimagesnewsmaltas-mica-licensing-comes-under-scrutiny-from-eu4abfd7ea5dc2.jpg Maltas MFSA … By Cointelegraph 2025-07-10
Researchers foil $10M DeFi backdoor in thousands of smart contracts !Researchers foil 10M DeFi backdoor in thousands of smart contractsimagesnewsresearchers-foil-10m-defi-backdoor-in-thousands-ofa87f082eaca0.jpg The … By Cointelegraph 2025-07-10
Coinbase unlocks off-exchange settlement for institutions amid ‘high’ demand !Coinbase unlocks off-exchange settlement for institutions amid high … By Cointelegraph 2025-07-10
Snoop Dogg’s Telegram NFT Drop Sold Out in Half an Hour The collab with Telegrams TON blockchain appears to show that celebrity-led NFTs, at least on apps like it, arent entirely dead. By Decrypt 2025-07-10
Circle's USDC Is Being Adopted by Jack Ma Payment Giant Ant Group The Chinese parent company of Alipay is set to incorporate the stablecoin into its blockchain platform, as per unconfirmed reports. By Decrypt 2025-07-10
XAI teases Grok upgrades; Musk says AI could discover new physics !XAI teases Grok upgrades Musk says AI could discover new physicsimagesnewsxai-teases-grok-upgrades-musk-says-ai-could-discov4ee51867775b.jpg Elon … By Cointelegraph 2025-07-10
Video Game Performers Secure AI Consent Rules in New SAG-AFTRA Deal Studios agree to strike suspension language preventing AI scabs and substantial pay increases through 2027. By Decrypt 2025-07-10
Linqto bankruptcy no threat to pre-IPO markets, says EquityZen !Linqto bankruptcy no threat to pre-IPO markets, says EquityZenimagesnewslinqto-bankruptcy-no-threat-to-pre-ipo-markets-sayba0530e5ad45.jpg Ripple … By Cointelegraph 2025-07-10
NFT sales hit $2.8B in first half of 2025 as trading volumes tank !NFT sales hit 2.8B in first half of 2025 as trading volumes tankimagesnewsnft-sales-hit-2-8b-in-first-half-of-2025-as-tradina8013c7429d5.jpg … By Cointelegraph 2025-07-10
Bitcoin treasury companies acquire record 159,107 BTC in Q2 !Bitcoin treasury companies acquire record 159,107 BTC in Q2imagesnewsbitcoin-treasury-companies-acquire-record-159107-bef7b0337d42c.jpg Corporate … By Cointelegraph 2025-07-10
Australia’s Tokenization Push Could Cement ‘Even Greater Financial Control’ Australia has approved 24 tokenized asset use cases under Project Acacia, enabling real-money trials across major banks and fintechs. By Decrypt 2025-07-10
Australia to test CBDCs, stablecoins in next stage of crypto play !Australia to test CBDCs, stablecoins in next stage of crypto playimagesnewsaustralia-to-test-cbdcs-stablecoins-in-next-stage-0ce391f226e4.jpg The … By Cointelegraph 2025-07-10
Bitcoin investors have now splashed over $50B on US spot ETFs !Bitcoin investors have now splashed over 50B on US spot ETFsimagesnewsbitcoin-investors-have-now-splashed-over-50b-on-usa992cc04c7af.jpg BlackRock … By Cointelegraph 2025-07-10
Nvidia becomes first company to hit $4T valuation, thanks to AI boom !Nvidia becomes first company to hit 4T valuation, thanks to AI boomimagesnewsnvidia-becomes-first-company-to-hit-4t-valuation-t5c4e2b9a9c40.jpg … By Cointelegraph 2025-07-10
Bitcoin Depot discloses data breach that doxed 27K customers !Bitcoin Depot discloses data breach that doxed 27K customersimagesnewsbitcoin-depot-discloses-data-breach-that-doxed-27kfe349f36f0fb.jpg Bitcoin … By Cointelegraph 2025-07-10
Bitcoiners underprepared for possible $133K price tag in September !Bitcoiners underprepared for possible 133K price tag in Septemberimagesnewsbitcoiners-underprepared-for-possible-133k-price-tf8759db0835a.jpg 10x … By Cointelegraph 2025-07-10
Elon Musk’s xAI Launches ‘Remarkable, Terrifying’ Grok 4 Model xAIs latest AI model aims to challenge OpenAI, even as the team quietly addresses past missteps this week. By Decrypt 2025-07-10
Ether rally to $3K this week highly likely: Here is why !Ether rally to 3K this week highly likely Here is whyimagesnewsether-rally-to-3k-this-week-highly-likely-here-is-664c6f046b6c.jpg Ethers price rally … By Cointelegraph 2025-07-10
Many see stablecoins soaring to $2T in ‘handful’ of years: Ripple CEO !Many see stablecoins soaring to 2T in handful of years Ripple CEOimagesnewsmany-see-stablecoins-soaring-to-2t-in-handful-of-y781ff8eb6d2e.jpg Ripple … By Cointelegraph 2025-07-10
Trump’s Truth Social Teases Upcoming Utility Token, Shills ‘Patriot’ Subscription The social platform founded by Donald Trump is rolling out a loyalty rewards system with plans for a utility token. By Decrypt 2025-07-10
NFTs back? Snoop Dogg’s Telegram ‘gifts’ sell out in 30 minutes !NFTs back? Snoop Doggs Telegram gifts sell out in 30 minutesimagesnewsnfts-back-snoop-doggs-telegram-gifts-sell-out-in-3b98aab44d133.jpg The NFT … By Cointelegraph 2025-07-10
‘See you at $150K,’ says Bitcoin bull after BTC taps new highs !See you at 150K, says Bitcoin bull after BTC taps new highsimagesnewssee-you-at-150k-says-bitcoin-bull-after-btc-taps-nbba772f610f6.jpg Economist … By Cointelegraph 2025-07-10
DeFi Lender Deploys $1M for Student Loans to the Philippines, Indonesia—But at What Cost? The launch positions education lending as a new use case for tokenized real-world assets, combining investor yield with social impact. By Decrypt 2025-07-10
Binance founder’s family office backs BNB treasury firm eyeing IPO !Binance founders family office backs BNB treasury firm eyeing IPOimagesnewsbinance-founders-family-office-backs-bnb-treasury-ca04ce82d77c.jpg … By Cointelegraph 2025-07-10
Judge Recommends Dropping Logan Paul’s Ex-Assistant From 'CryptoZoo' Lawsuit Logan Pauls former assistant Danielle Strobels early token access and equity stake werent enough to establish jurisdiction, a judge found. By Decrypt 2025-07-10
Emirates Airline Adding Crypto Payments, Years After Teasing Bitcoin Plans Emirates is working with Crypto.com to enable cryptocurrency payments, three years after first announcing a Bitcoin integration. By Decrypt 2025-07-10
BONK news update: Will LetsBonk’s surging popularity push the altcoin above $0.000026? !BONK news update Will LetsBonks surging popularity push the altcoin above … By Cointelegraph 2025-07-09
Bitcoin Treasury Firm Thumzup Considering Dogecoin, XRP Buys as Trump Jr. Invests Publicly traded Thumzup is considering whether it should stash more cryptocurrencies beyond Bitcoin, including Dogecoin, Solana, and XRP. By Decrypt 2025-07-09
Chinese creditor challenges FTX motion to halt payouts in restricted countries !Chinese creditor challenges FTX motion to halt payouts in restricted … By Cointelegraph 2025-07-09
AI Ghostwriting Is Creeping Into Science—Is That a Bad Thing? A new study of 15 million biomedical papers found telltale language patterns linked to ChatGPT, suggesting that AI tools are reshaping scientific … By Decrypt 2025-07-09
Donald Trump Jr. invests in social media-turned BTC treasury firm !Donald Trump Jr. invests in social media-turned BTC treasury firmimagesnewsdonald-trump-jr-invests-in-social-media-turned-btc2f26280df94a.jpg The … By Cointelegraph 2025-07-09
'Just Salty': El Salvador President Bukele Mocks Senate Democrats Over Bitcoin Scrutiny Senate Democrats want an investigation into Salvadoran president Nayib Bukeles use of crypto. The popular leader finds it hilarious. By Decrypt 2025-07-09
US debt rises to $36.6T: Will recession signals send Bitcoin back to $95K? !US debt rises to 36.6T Will recession signals send Bitcoin back to 95K?imagesnewsus-debt-rises-to-36-6t-will-recession-signals-send155a28f9d746.jpg … By Cointelegraph 2025-07-09
Trump family-backed business votes on making governance token tradable !Trump family-backed business votes on making governance token tradableimagesnewstrump-family-backed-business-votes-on-making-gover503b1d79692b.jpg … By Cointelegraph 2025-07-09
Bitcoin soars to new all-time high above $112K as traders liquidate shorts !Bitcoin soars to new all-time high above 112K as traders liquidate … By Cointelegraph 2025-07-09
Bitcoin Surges to New All-Time High Price Above $112K The price of Bitcoin spiked to a new record price above 112,000 on Coinbase, continuing this years trend of fresh peaks. By Decrypt 2025-07-09
Hyperliquid news update: Growing user base could send HYPE back to $45 !Hyperliquid news update Growing user base could send HYPE back to 45imagesnewshyperliquid-news-update-growing-user-base-could-se716d0d88b86e.jpg … By Cointelegraph 2025-07-09
US SEC ‘Crypto Mom’ clarifies: ‘Tokenized securities are still securities’ !US SEC Crypto Mom clarifies Tokenized securities are still securitiesimagesnewsus-sec-crypto-mom-clarifies-tokenized-securities-ab145dfde9e2e.jpg … By Cointelegraph 2025-07-09
Why a 'Mobile-First' Mentality Drove OpenSea's Latest Acquisition Major NFT and token trading platform OpenSea will increase its mobile focus after acquiring the team behind crypto portfolio app Rally. By Decrypt 2025-07-09
Trump Ally Compares Crypto Industry Writing Its Own Rules to Spilled 'Urine Sample' John Kennedy R-LA and other senators raised concerns about crypto market structure legislation during a Senate hearing Wednesday. By Decrypt 2025-07-09
Will XRP hit new highs as Ripple participates in US Senate Web3 summit? !Will XRP hit new highs as Ripple participates in US Senate Web3 summit?imagesnewswill-xrp-hit-new-highs-as-ripple-participates-in-u8e455a58170b.jpg … By Cointelegraph 2025-07-09
Crypto Exchange GMX Drained of Bitcoin, Ethereum in $40 Million Exploit GMX has offered the attacker a 10 white-hat bounty after some 40 million worth of assets were swiped from the crypto protocol. By Decrypt 2025-07-09
Bye-Bye 'MechaHitler': Elon Musk's xAI Quietly Fixed Grok by Deleting a Line of Code Groks Nazi-sympathizing responses sparked backlash this week, but the fix reveals how a single prompt instruction can shape an AIs entire political … By Decrypt 2025-07-09
GMX halts trading, token minting following $40 million exploit !GMX halts trading, token minting following 40 million exploitimagesnewsgmx-halts-trading-token-minting-following-40-milli21c477febc00.jpg The … By Cointelegraph 2025-07-09
PUMP.FUN TOKENOMICS, $HYPE, BONKGUY META ETH leads crypto majors higher, BTC dominance falls. US House taking steps for US to be crypto capital. Sharplink to buy 20m ETH, stock pops 12. … By Decrypt 2025-07-09
Why Are Bitcoin, Ethereum and Solana Prices Still Rangebound? Experts Weigh In The crypto market remains rangebound as President Trump again revisits tariff negotiations with U.S. trading partners. By Decrypt 2025-07-09
Detroit Man Admits Sending Crypto Intended for ISIS Jibreel Pratt used encrypted tools to send Bitcoin he thought would support ISIS, but undercover agents were already tracking his moves. By Decrypt 2025-07-09
US CLARITY bill could allow Tesla and Meta to evade SEC rules — Senator Warren !US CLARITY bill could allow Tesla and Meta to evade SEC rules Senator … By Cointelegraph 2025-07-09
Robinhood stock nears record high as tokenization strategy gains traction !Robinhood stock nears record high as tokenization strategy gains … By Cointelegraph 2025-07-09
Germany’s top banks managing $4.5 trillion+ in assets are going crypto—Here’s what to watch !Germanys top banks managing 4.5 trillion in assets are going cryptoHeres what to … By Cointelegraph 2025-07-09
LetsBonk overtakes Pump.fun: Are Solana memecoins back for good? !LetsBonk overtakes Pump.fun Are Solana memecoins back for good?imagesnewsletsbonk-overtakes-pump-fun-are-solana-memecoins-b3c1311a7836b.jpg Key … By Cointelegraph 2025-07-09
Bitcoin rich list 2025: Who holds the most BTC this year? !Bitcoin rich list 2025 Who holds the most BTC this year?imagesnewsbitcoin-rich-list-2025-who-holds-the-most-btc-this303057153b7a.jpg From exchanges … By Cointelegraph 2025-07-09
Tornado Cash Judge Won’t Let One Case Be Mentioned in Roman Storm’s Trial: Here’s Why Judge Failla said mentioning the Van Loon ruling would confuse jurors, outweighing its limited value in Roman Storms upcoming trial. By Decrypt 2025-07-09
Bitcoin analyst warns time 'running out' for another BTC price parabolic rally !Bitcoin analyst warns time running out for another BTC price parabolic … By Cointelegraph 2025-07-09
ETH CONTINUES TO RISE, PHANTOM LAUNCHES PERPS, TRUMP SHELVES TARIFFS ETH leads crypto majors higher, BTC dominance falls. US House taking steps for US to be crypto capital. Sharplink to buy 20m ETH, stock pops 12. … By Decrypt 2025-07-09
Solana Meme Coin Launchpad Pump.fun Confirms PUMP Token—With Airdrop 'Coming Soon' Pump.fun launches massive PUMP token ICO July 12 across major exchanges, but US and UK users banned from the potentially record-breaking sale. By Decrypt 2025-07-09
Ripple Chooses BNY Mellon for Stablecoin Custodian as RLUSD Reaches $500 Million Ripples CEO said the tie-up with BNY Mellon represents how regulatory headwinds are no longer a reality for the firm. By Decrypt 2025-07-09
Linda Yaccarino Leaves Elon Musk's X Following Grok 'MechaHitler' Debacle X CEO Linda Yaccarino has stepped down from Elon Musks social media platform, one day after AI chatbot Grok pivoted to antisemitism. By Decrypt 2025-07-09
ARK Flags Bearish Bitcoin Signal Despite BTC Price Stability Bitcoins bullish momentum fades as new buyers decline, but long-term holders reach 15-year highs while BTC dominance surges to 65, says ARK Invest. By Decrypt 2025-07-09
Is Ethereum pushing too hard with 6-second blocks? Here’s the truth !Is Ethereum pushing too hard with 6-second blocks? Heres the truthimagesnewsis-ethereum-pushing-too-hard-with-6-second-blocks-b87ed4f73c51.jpg … By Cointelegraph 2025-07-09
Bitcoin to test $110K as macro analysis tells traders to 'buckle up' !Bitcoin to test 110K as macro analysis tells traders to buckle upimagesnewsbitcoin-to-test-110k-as-macro-analysis-tells-trade89a1ad9ae429.jpg … By Cointelegraph 2025-07-09
Japanese firm Remixpoint raises $215M to expand Bitcoin treasury holdings !Japanese firm Remixpoint raises 215M to expand Bitcoin treasury holdingsimagesnewsjapanese-firm-remixpoint-raises-215m-to-expand-bitad5c5645b6bd.jpg … By Cointelegraph 2025-07-09
XRP 'finally breaking out' with 12% rally after Ripple-BNY Mellon deal !XRP finally breaking out with 12 rally after Ripple-BNY Mellon dealimagesnewsxrp-finally-breaking-out-with-12-rally-after-rippl82ca9ae0c573.jpg … By Cointelegraph 2025-07-09
$30 Trillion Trade System Still Uses Faxes – Can XDC Fix It? !30 Trillion Trade System Still Uses Faxes Can XDC Fix It?imagesnews30-trillion-trade-system-still-uses-faxes-can-xdc-9ebd17e4e407.jpg The growing … By Cointelegraph 2025-07-09
Polygon’s ‘most complex’ hard fork goes live Thursday !Polygons most complex hard fork goes live Thursdayimagesnewspolygons-most-complex-hard-fork-goes-live-thursday84b0e31ba9a9.jpg Polygon Foundation … By Cointelegraph 2025-07-09
Musk’s America Party may support Bitcoin but still faces third-party pitfalls !Musks America Party may support Bitcoin but still faces third-party … By Cointelegraph 2025-07-09
Ripple’s RLUSD launches on Transak as market cap hits $500M !Ripples RLUSD launches on Transak as market cap hits 500Mimagesnewsripples-rlusd-launches-on-transak-as-market-cap-hi3e38dc582678.jpg Launched in … By Cointelegraph 2025-07-09
What Are Prediction Markets? Understanding How Myriad Works On-chain prediction markets such as Myriad have rapidly gained traction in recent years. Heres how they work. By Decrypt 2025-07-09
Pump.fun token sale confirmed, Europe-based users barred: Bybit !Pump.fun token sale confirmed, Europe-based users barred Bybitimagesnewspump-fun-token-sale-confirmed-europe-based-users-b9989d54cf1a2.jpg Bybit … By Cointelegraph 2025-07-09
Ethereum corporate treasuries critical for the ecosystem: Joseph Lubin !Ethereum corporate treasuries critical for the ecosystem Joseph Lubinimagesnewsethereum-corporate-treasuries-critical-for-the-eco5a2dd1bd3926.jpg … By Cointelegraph 2025-07-09
Getting Started With Myriad Myriads prediction market ecosystem enables you to make predictions using points and USDC. Heres how to get set up and start using it. By Decrypt 2025-07-09
Emirates airline signs MoU with Crypto.com to enable crypto payments !Emirates airline signs MoU with Crypto.com to enable crypto paymentsimagesnewsemirates-airline-signs-mou-with-crypto-com-to-enaba83cb9c4b64e.jpg … By Cointelegraph 2025-07-09
SOL price ’bull chart’ targets $300 as Solana ETF approval odds hit 99.7% !SOL price bull chart targets 300 as Solana ETF approval odds hit 99.7imagesnewssol-price-bull-chart-targets-300-as-solana-etf-app4e9b848ba4e7.jpg … By Cointelegraph 2025-07-09
South Korea plans to lift crypto venture business restrictions !South Korea plans to lift crypto venture business restrictionsimagesnewssouth-korea-plans-to-lift-crypto-venture-business-9dc842a07784.jpg South … By Cointelegraph 2025-07-09
OmegaPro Founders Charged Over $650 Million Crypto ‘Global Fraud Scheme’ The duo allegedly used lavish Dubai events and luxury displays to lure investors into a bogus forex scheme that collapsed in 2023. By Decrypt 2025-07-09
Bitcoin gets ‘highly favorable’ cues as DXY sets 21-year weakness record !Bitcoin gets highly favorable cues as DXY sets 21-year weakness recordimagesnewsbitcoin-gets-highly-favorable-cues-as-dxy-sets-21-919b7e96e095.jpg … By Cointelegraph 2025-07-09
Crypto groups back lawsuit against DOJ crackdown on open-source code !Crypto groups back lawsuit against DOJ crackdown on open-source codeimagesnewscrypto-groups-back-lawsuit-against-doj-crackdown-o0adbc3a5d404.jpg A … By Cointelegraph 2025-07-09
OpenSea expands to mobile with Rally deal, eyes ‘onchain everything app’ !OpenSea expands to mobile with Rally deal, eyes onchain everything appimagesnewsopensea-expands-to-mobile-with-rally-deal-eyes-oncaef03c9d1cd8.jpg … By Cointelegraph 2025-07-09
Circle and OKX launch zero-fee USDC conversions to US dollar !Circle and OKX launch zero-fee USDC conversions to US dollarimagesnewscircle-and-okx-launch-zero-fee-usdc-conversions-to3b9ee44400dd.jpg OKX is … By Cointelegraph 2025-07-09
New Zealand bans crypto ATMs in crackdown on criminal cash conversions !New Zealand bans crypto ATMs in crackdown on criminal cash conversionsimagesnewsnew-zealand-bans-crypto-atms-in-crackdown-on-crimi4b9d05ee0449.jpg … By Cointelegraph 2025-07-09
Bitcoin lacks ‘sustained momentum’ for new high as traders are hesitant !Bitcoin lacks sustained momentum for new high as traders are hesitantimagesnewsbitcoin-lacks-sustained-momentum-for-new-high-as-tbd329f60a4b6.jpg … By Cointelegraph 2025-07-09
SharpLink Gaming pops 28% as Ethereum holdings surpass $533M !SharpLink Gaming pops 28 as Ethereum holdings surpass 533Mimagesnewssharplink-gaming-pops-28-as-ethereum-holdings-surpd74d569dde23.jpg SharpLink … By Cointelegraph 2025-07-09
US charges 2 men over $650M OmegaPro crypto scam !US charges 2 men over 650M OmegaPro crypto scamimagesnewsus-charges-2-men-over-650m-omegapro-crypto-scam5ee58283b7bb.jpg US prosecutors charged two … By Cointelegraph 2025-07-09
New Zealand to Ban Crypto ATMs, Cap Transfers in AML Regime Shake-Up With 221 machines nationwide, New Zealand joins countries reining in crypto kiosks over rising financial crime concerns. By Decrypt 2025-07-09
Inside North Korea's Hiring Scams Targeting Crypto Firms Companies and recruiters are warning that North Korea is hiring Europeans as fronts for job interviews, and the problem is only getting worse. By Decrypt 2025-07-09
Bitcoin lacked mass media coverage in Q2: Report !Bitcoin lacked mass media coverage in Q2 Reportimagesnewsbitcoin-lacked-mass-media-coverage-in-q2-reporta7e6931ad990.jpg Major news outlets The Wall … By Cointelegraph 2025-07-09
Grok Glitch Inspires Wave of ‘MechaHitler’ Meme Coins Rogue AI hallucinations by Grok have given rise to new crypto memes as well as associated tokens on Solana and Ethereum. By Decrypt 2025-07-09
Crypto traders ‘starting to salivate’ as Bitcoin inches back toward $110K !Crypto traders starting to salivate as Bitcoin inches back toward 110Kimagesnewscrypto-traders-starting-to-salivate-as-bitcoin-ince8a0e65c1756.jpg … By Cointelegraph 2025-07-09
US sanctions North Korean tech worker crew over crypto thefts !US sanctions North Korean tech worker crew over crypto theftsimagesnewsus-sanctions-north-korean-tech-worker-crew-over-cre122a36f1e62.jpg TRM Labs … By Cointelegraph 2025-07-09
Goblintown Heads to the Trenches With Solana Meme Coin Launch The creator of Ethereum NFT collection Goblintown thinks theres a better way to launch meme coinsand it just did so with GOB on Solana. By Decrypt 2025-07-09
Polymarket Rules 'No' on $237M Controversial Bet Over Zelenskyy's Suit Discontent over the markets resolution has reignited scrutiny of UMAs dispute system and the influence of large Polymarket stakeholders. By Decrypt 2025-07-09
Meet 'MechaHitler:' Grok’s New Disturbing Persona Grok maker xAI quietly updated its chatbot to assume all media is biased, relying on X, a platform known for misinformation. By Decrypt 2025-07-09
Grok 4 Drops Tomorrow—Here's How Musk's AI Might Steal GPT-5's Thunder The latest xAI model promises specialized coding capabilities, benchmark-beating reasoning, and something GPT-5 doesnt have availability. By Decrypt 2025-07-08
Why Ethereum Layer-2 Arbitrum Is Built to Power AAA Games: Offchain Labs CEO The flexibility of Arbitrums tech stack should make the layer-2 network a go-to for game developers, Offchain Labs CEO Steven Goldfeder said. By Decrypt 2025-07-08
Bitcoin metric says $100K BTC was the bottom: When will a rally to new highs start? !Bitcoin metric says 100K BTC was the bottom When will a rally to new highs … By Cointelegraph 2025-07-08
Hackers Target Bitcoin Wallet Holding Billions Swiped From Mt. Gox Scammers appear to be targeting a Bitcoin address holding 8.7 billion in BTCstolen from the Mt. Gox exchangewith a phishing attempt. By Decrypt 2025-07-08
ChatGPT Sent Users to a Website for a Feature It Didn't Have—So the Founder Built It After ChatGPT falsely claimed that a feature existed at a music tabs website, Soundslice built it to meet user demand. By Decrypt 2025-07-08
$31B stablecoin surge at Binance revives traders’ altseason hopes !31B stablecoin surge at Binance revives traders altseason hopesimagesnews31b-stablecoin-surge-at-binance-revives-traders-ala57658862bb6.jpg Soaring … By Cointelegraph 2025-07-08
BioSig, Streamex target gold tokenization with $1.1B financing !BioSig, Streamex target gold tokenization with 1.1B financingimagesnewsbiosig-streamex-target-gold-tokenization-with-1-1b67384148c633.jpg With eyes … By Cointelegraph 2025-07-08
Will Bitcoin Breakout This Week? Price Charts Flash Mixed Signals With a prediction market deadline fast approaching, traders on Myriad are split as momentum wanes and resistance looms just above the 109K price mark … By Decrypt 2025-07-08
SOL futures funding rate turns negative: Is $180 the next stop? !SOL futures funding rate turns negative Is 180 the next stop?imagesnewssol-futures-funding-rate-turns-negative-is-180-thec1b27e28b056.jpg Blockchain … By Cointelegraph 2025-07-08
Judge signals Tornado Cash sanctions may be barred from Roman Storm trial !Judge signals Tornado Cash sanctions may be barred from Roman Storm … By Cointelegraph 2025-07-08
'OpenSeason' Crypto Game Goes Offline as Devs Pivot to Gambling on Nudity Fractional Uprisings team has shifted gears after its token plummeted, hoping to draw in degens with AI-generated nudity and crypto gambling. By Decrypt 2025-07-08
Projective Finance opens $7M onchain lending pool for Illinois solar projects !Projective Finance opens 7M onchain lending pool for Illinois solar … By Cointelegraph 2025-07-08
SOL news update: Bullish chart setup trumps Solana ETF delay !SOL news update Bullish chart setup trumps Solana ETF delayimagesnewssol-news-update-bullish-chart-setup-trumps-solana-978ca55ca4f3.jpg SOLs chart … By Cointelegraph 2025-07-08
Ripple CEO, ex-US regulators to address market structure at Senate hearing !Ripple CEO, ex-US regulators to address market structure at Senate … By Cointelegraph 2025-07-08
ETH news update: Will Ether ETF buying help bulls secure close above $2.7K? !ETH news update Will Ether ETF buying help bulls secure close above … By Cointelegraph 2025-07-08
SharpLink Gaming Stock Soars as Ethereum Treasury Firm Boosts Stash to $527 Million The Ethereum treasury firm is buying the second biggest digital coin to help shareholders get better value for money. By Decrypt 2025-07-08
ReserveOne to go public via merger, create crypto reserve !ReserveOne to go public via merger, create crypto reserveimagesnewsreserveone-to-go-public-via-merger-create-crypto-rdb0e7512d801.jpg RerserveOne is … By Cointelegraph 2025-07-08
Bitcoin news update: BTC range tightening hints at price break to new highs !Bitcoin news update BTC range tightening hints at price break to new … By Cointelegraph 2025-07-08
Japanese company moves to align CEO with Bitcoin strategy, full salary goes to BTC !Japanese company moves to align CEO with Bitcoin strategy, full salary goes to … By Cointelegraph 2025-07-08
AMERICA INVEST ACT, CORP TREASURY STOCKS & PUMP FUN Crypto dips on tariff letters, then recovers. ETH outperforms, altcoins weak after PumpFun news. PumpFun plans 600m token sale, 4b valuation. Trump … By Decrypt 2025-07-08
CoreWeave’s Core Scientific acquisition sparks analyst doubts as stock dips !CoreWeaves Core Scientific acquisition sparks analyst doubts as stock … By Cointelegraph 2025-07-08
Trump Media Files for 'Crypto Blue Chip' ETF Holding Bitcoin, Ethereum, Solana and XRP Trump Media and Technology Group is looking to launch another Truth Social-branded crypto ETF for Bitcoin, Ethereum, XRP, and more. By Decrypt 2025-07-08
Bitcoin price gained 72% and 84% the last two times BTC holders did this !Bitcoin price gained 72 and 84 the last two times BTC holders did thisimagesnewsbitcoin-price-gained-72-and-84-the-last-two-times-400e25b41c3d.jpg … By Cointelegraph 2025-07-08
Crypto Treasury ReserveOne Eyes Nasdaq Listing Via $1 Billion SPAC Deal The companys board of directors includes names from Coinbase, Binance, and Trumps first administration. By Decrypt 2025-07-08
Ego Death Capital raises $100M to finance Bitcoin-focused startups !Ego Death Capital raises 100M to finance Bitcoin-focused startupsimagesnewsego-death-capital-raises-100m-to-finance-bitcoin-f8df0a33ae644.jpg The … By Cointelegraph 2025-07-08
Which countries secretly own the most Bitcoin — beyond the US and China !Which countries secretly own the most Bitcoin beyond the US and Chinaimagesnewswhich-countries-secretly-own-the-most-bitcoin-beyoac303d81800b.jpg … By Cointelegraph 2025-07-08
CRYPTO DIPS THEN RECOVERS, PUMPFUN PLANS TOKEN SALE, TARIFF HEADLINES RETURN Crypto dips on tariff letters, then recovers. ETH outperforms, altcoins weak after PumpFun news. PumpFun plans 600m token sale, 4b valuation. Trump … By Decrypt 2025-07-08
Bitcoin Volatility Hovers Near Historical Low, but 'Beware the Quiet,' Analysts Warn The QCP Capital analysts warned that Q3-Q4 could bring fireworks as ETF inflows create a supply squeeze. By Decrypt 2025-07-08
Ethereum 'mega whales' are stacking harder than pre-95% rally in 2002 !Ethereum mega whales are stacking harder than pre-95 rally in 2002imagesnewsethereum-mega-whales-are-stacking-harder-than-pre-44e1ea1914a6.jpg … By Cointelegraph 2025-07-08
Robinhood CEO Wants 'Thousands' of Private Companies Tokenized on Platform OpenAI denounced Robinhoods offering of its private stock as a crypto token, but the trading app wants to add thousands more to its roster. By Decrypt 2025-07-08
Blockchain restores women’s power in AI !Blockchain restores womens power in AIimagesnewsblockchain-restores-womens-power-in-ai8194632b332b.jpg As AI threatens to deepen gender disparities … By Cointelegraph 2025-07-08
Thailand’s 5-year crypto tax break: What they’re not telling you !Thailands 5-year crypto tax break What theyre not telling youimagesnewsthailands-5-year-crypto-tax-break-what-theyre-not-ba0e7ee102fd.jpg Thailands … By Cointelegraph 2025-07-08
UK Jails Duo for $2M Fake Crypto Consultancy Scam The scheme involved the pair cold-calling 65 victims and convincing them to invest in a fake crypto consultancy firm. By Decrypt 2025-07-08
Falcon USD stablecoin loses dollar peg amid liquidity, collateral concerns !Falcon USD stablecoin loses dollar peg amid liquidity, collateral … By Cointelegraph 2025-07-08
Truth Social files S-1 for ‘Crypto Blue Chip ETF,’ tracking top assets !Truth Social files S-1 for Crypto Blue Chip ETF, tracking top assetsimagesnewstruth-social-files-s-1-for-crypto-blue-chip-etf-tra44adcf4ed91.jpg … By Cointelegraph 2025-07-08
Ripple shareholder Linqto files for Chapter 11 bankruptcy !Ripple shareholder Linqto files for Chapter 11 bankruptcyimagesnewsripple-shareholder-linqto-files-for-chapter-11-bane0212a0e31d8.jpg Ripple … By Cointelegraph 2025-07-08
Huione wallets moved $1B to crypto exchanges since FinCEN action !Huione wallets moved 1B to crypto exchanges since FinCEN actionimagesnewshuione-wallets-moved-1b-to-crypto-exchanges-since-ed2964861a5c.jpg … By Cointelegraph 2025-07-08
How to use a crypto hardware wallet: A step-by-step guide !How to use a crypto hardware wallet A step-by-step guideimagesnewshow-to-use-a-crypto-hardware-wallet-a-step-by-step8b90f31a412e.jpg You can set up … By Cointelegraph 2025-07-08
Private companies line up to join Robinhood’s tokenized equity platform: CEO !Private companies line up to join Robinhoods tokenized equity platform … By Cointelegraph 2025-07-08
BlackRock's Bitcoin ETF Breaks the 700,000 BTC Barrier The funds popularity could help Bitcoins volatility remain relatively lowat least in the short term, according to analysts. By Decrypt 2025-07-08
Pakistan launches crypto regulatory body for digital asset sector !Pakistan launches crypto regulatory body for digital asset sectorimagesnewspakistan-launches-crypto-regulatory-body-for-digit4a7ae7e14bbe.jpg … By Cointelegraph 2025-07-08
South Korean bank stocks surge on stablecoin trademark filings !South Korean bank stocks surge on stablecoin trademark filingsimagesnewssouth-korean-bank-stocks-surge-on-stablecoin-trade01497f8b9584.jpg Shares of … By Cointelegraph 2025-07-08
TON’s UAE ‘golden visa’ mishap shows why legal reviews matter !TONs UAE golden visa mishap shows why legal reviews matterimagesnewstons-uae-golden-visa-mishap-shows-why-legal-review6f0cde570970.jpg The TON … By Cointelegraph 2025-07-08
XRP price must break this key level to reclaim $3 !XRP price must break this key level to reclaim 3imagesnewsxrp-price-must-break-this-key-level-to-reclaim-3497f3a1645a1.jpg XRP price flips key … By Cointelegraph 2025-07-08
What Are Coin Mixers and How Do They Work? Coin mixers like Tornado Cash have faced sanctions for aiding money laundering, but advocates argue they have legitimate use cases. By Decrypt 2025-07-08
Crypto fundraising surges to $10B in Q2, highest since early 2022 !Crypto fundraising surges to 10B in Q2, highest since early 2022imagesnewscrypto-fundraising-surges-to-10b-in-q2-highest-sin8c5a91a2f622.jpg Crypto … By Cointelegraph 2025-07-08
Bitcoin Mayer Multiple shows $108K BTC price undervalued: Analysis !Bitcoin Mayer Multiple shows 108K BTC price undervalued Analysisimagesnewsbitcoin-mayer-multiple-shows-108k-btc-price-undervca941f6896ee.jpg Bitcoin … By Cointelegraph 2025-07-08
Metaplanet eyes digital bank acquisition in phase 2 of Bitcoin strategy !Metaplanet eyes digital bank acquisition in phase 2 of Bitcoin strategyimagesnewsmetaplanet-eyes-digital-bank-acquisition-in-phase-d2f89c9aa6e0.jpg … By Cointelegraph 2025-07-08
Bitcoin miner BitFuFu mines 445 BTC for its biggest production month !Bitcoin miner BitFuFu mines 445 BTC for its biggest production monthimagesnewsbitcoin-miner-bitfufu-mines-445-btc-for-its-bigges7117970828ad.jpg … By Cointelegraph 2025-07-08
Bots behind most tokens on Pump.fun and LetsBonk: Coinbase exec !Bots behind most tokens on Pump.fun and LetsBonk Coinbase execimagesnewsbots-behind-most-tokens-on-pump-fun-and-letsbonk-cb7802bc82ab4.jpg Bots are … By Cointelegraph 2025-07-08
BlackRock iShares Bitcoin ETF surpasses 700K Bitcoin !BlackRock iShares Bitcoin ETF surpasses 700K Bitcoinimagesnewsblackrock-ishares-bitcoin-etf-surpasses-700k-bitco00156660ead7.jpg BlackRocks iShares … By Cointelegraph 2025-07-08
Vitalik Buterin advocates ‘copyleft’ licensing in crypto !Vitalik Buterin advocates copyleft licensing in cryptoimagesnewsvitalik-buterin-advocates-copyleft-licensing-in-cr0ea4d5689b7a.jpg Ethereum … By Cointelegraph 2025-07-08
SEC acknowledges Trump’s Truth Social Bitcoin and Ethereum ETF !SEC acknowledges Trumps Truth Social Bitcoin and Ethereum ETFimagesnewssec-acknowledges-trumps-truth-social-bitcoin-and-e56dab5f01fcf.jpg The … By Cointelegraph 2025-07-08
DigitalX Taps Animoca’s Yat Siu, Raises $13.5M to Buy Bitcoin Roughly 12.8 million will go toward Bitcoin purchases, with the remainder slated for operating expenses and working capital. By Decrypt 2025-07-08
Coinbase crypto lobby urges Congress to back major crypto bill !Coinbase crypto lobby urges Congress to back major crypto billimagesnewscoinbase-crypto-lobby-urges-congress-to-back-major2b684f03f4a6.jpg US House … By Cointelegraph 2025-07-08
Apple’s Top AI Exec Leaves For Meta Amid Aggressive Hiring Trend The executives departure signals intensifying competition for elite talent and deepens concerns over Apples generative AI strategy. By Decrypt 2025-07-08
Shenzhen Warns of Stablecoin Scams as Neighboring Hong Kong Pushes Ahead Mainland officials have urged public caution amid a rise in crypto fraud as Hong Kong prepares to roll out rules for stablecoin issuers. By Decrypt 2025-07-08
US Politician’s Tweet Revives Cultural Debate Over UAPs A viral post has reignited debate over whether some UFO sightings may reflect ancient religious imagery rather than extraterrestrial life. By Decrypt 2025-07-08
Gate.io deletes page showing a $600M Pump.fun token sale !Gate.io deletes page showing a 600M Pump.fun token saleimagesnewsgate-io-deletes-page-showing-a-600m-pump-fun-token7448cb2c68e0.jpg Crypto exchange … By Cointelegraph 2025-07-08
Here's How All Major AI Platforms Stacked Up in a Harry Potter Sorting Hat Quiz A developer tested 17 language models and discovered theyre overwhelmingly associated with the Ravenclaw team, with one notable exception. By Decrypt 2025-07-07
'Evil' Proposal to Sell Gaza Land Via Crypto Tokens Met With Backlash Palestinian activists blasted the proposed plan to sell Gaza via crypto tokens and establish blockchain-trade initiatives. By Decrypt 2025-07-07
Rescue Drones Deployed Amid Texas, North Carolina Floods—But Hobbyists Are Grounded With emergency crews relying on drones to save lives in flooded areas of Texas and the Carolinas, authorities are imposing no-fly zones to keep out … By Decrypt 2025-07-07
Two Ethereum Genesis wallets wake, move $2.9M ETH !Two Ethereum Genesis wallets wake, move 2.9M ETHimagesnewstwo-ethereum-genesis-wallets-wake-move-2-9m-ethc1a52951cdc9.jpg Ether has appreciated … By Cointelegraph 2025-07-07
Solana Meme Coin Launchpad Pump.Fun's $600 Million Token Sale Teased, Then Pulled Is Pump.fun finally launching its own token? Crypto exchange Gate said yes on Monday, but then apparently removed the page. By Decrypt 2025-07-07
Ethereum OG Moves $2.2 Million in 'Genesis Coins' After 10 Years HODLing The address received the coins when ETH was worth less than 50 cents. By Decrypt 2025-07-07
Casascius bar owner gets less physical, moves BTC to wallet after 13 years !Casascius bar owner gets less physical, moves BTC to wallet after 13 … By Cointelegraph 2025-07-07
Bitcoin data points to rally to $120K after pro BTC traders abandon their bearish bets !Bitcoin data points to rally to 120K after pro BTC traders abandon their bearish … By Cointelegraph 2025-07-07
Robinhood’s OpenAI, SpaceX private equity tokens face EU scrutiny !Robinhoods OpenAI, SpaceX private equity tokens face EU scrutinyimagesnewsrobinhoods-openai-spacex-private-equity-tokens-fac4d5516b35253.jpg … By Cointelegraph 2025-07-07
Trump Is Making Bank on Crypto: Do Voters Care? A new poll from a pro-crypto group asserts most voters are unaware of the presidents personal digital assets ventureswhich have recently threatened … By Decrypt 2025-07-07
CleanSpark mines 685 BTC in June, scales hashrate 145% YoY !CleanSpark mines 685 BTC in June, scales hashrate 145 YoYimagesnewscleanspark-mines-685-btc-in-june-scales-hashrate-14ce8690fac42.jpg CleanSpark … By Cointelegraph 2025-07-07
Court ends Coin Center-US Treasury appeal over Tornado Cash !Court ends Coin Center-US Treasury appeal over Tornado Cashimagesnewscourt-ends-coin-center-us-treasury-appeal-over-tor162438d1249b.jpg The … By Cointelegraph 2025-07-07
Bitcoin futures pivot to long positions: Is $112K the next stop? !Bitcoin futures pivot to long positions Is 112K the next stop?imagesnewsbitcoin-futures-pivot-to-long-positions-is-112k-th975c5c2cfa6c.jpg Bitcoin … By Cointelegraph 2025-07-07
Moon or Doom: Will Bitcoin Stay Above $100K in July? Can Bitcoin hold 100K? Prediction market users on Myriad are bullish on the odds, but the charts suggest it might be a close call. By Decrypt 2025-07-07
'Off the Grid' GUN Token Expanding From Avalanche to Solana—Here's Why After first launching on Avalanche, the GUN token from shooter game Off the Grid is now coming to Solanaand maybe more chains ahead. By Decrypt 2025-07-07
5 countries where crypto is (surprisingly) tax-free in 2025 !5 countries where crypto is surprisingly tax-free in 2025imagesnews5-countries-where-crypto-is-surprisingly-tax-free-56e0cc9b4a06.jpg Looking to … By Cointelegraph 2025-07-07
Price predictions 7/7: SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE !Price predictions 77 SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPEimagesnewsprice-predictions-7-7-spx-dxy-btc-eth-xrp-bnb-sol-3a9ef773e23f.jpg … By Cointelegraph 2025-07-07
Bitcoin Buying Sprees Accelerate as Metaplanet, Semler Stack More BTC A pair of Bitcoin treasury firms added to their stash on Monday. By Decrypt 2025-07-07
How Vietnam is using crypto to fix its FATF reputation !How Vietnam is using crypto to fix its FATF reputationimagesnewshow-vietnam-is-using-crypto-to-fix-its-fatf-reputa50dd7b57b520.jpg Vietnam is … By Cointelegraph 2025-07-07
Bit Digital shifts treasury strategy with 100K ETH buy; stock surges 29% !Bit Digital shifts treasury strategy with 100K ETH buy stock surges 29imagesnewsbit-digital-shifts-treasury-strategy-with-100k-ethff1607972402.jpg … By Cointelegraph 2025-07-07
Treasury Department Drops Case Over Ethereum Mixer Tornado Cash Months after dropping sanctions against Ethereum coin mixer Tornado Cash, the U.S. Treasury has agreed to end a related legal battle. By Decrypt 2025-07-07
Ethereum Co-Founder Vitalik Buterin Floats Gas Cap for ZK ‘Endgame’ Ethereums community has worked toward integrating zero-knowledge proofs into the network for nearly a decade. By Decrypt 2025-07-07
AI Giant CoreWeave to Buy Bitcoin Miner Core Scientific in $9B Deal The deal is expected to close by the end of this year. By Decrypt 2025-07-07
UAE Golden Visa is ‘being developed independently‘ — TON Foundation !UAE Golden Visa is being developed independently TON Foundationimagesnewsuae-golden-visa-is-being-developed-independently-t31241e6a9fe4.jpg The TON … By Cointelegraph 2025-07-07
4 signs that the Ethereum price uptrend to $5K is back in play !4 signs that the Ethereum price uptrend to 5K is back in playimagesnews4-signs-that-the-ethereum-price-uptrend-to-5k-is-b89b1ab4fce8a.jpg Despite … By Cointelegraph 2025-07-07
Strategy Reveals $4.2 Billion Stock Sale After Missing First Weekly Bitcoin Buy in 3 Months Strategy holds more than 593,000 Bitcoin with a current value of roughly 65 billion. By Decrypt 2025-07-07
CoreWeave finalizes Core Scientific acquisition for $9B !CoreWeave finalizes Core Scientific acquisition for 9Bimagesnewscoreweave-finalizes-core-scientific-acquisition-foc358aa8caa07.jpg CoreWeave … By Cointelegraph 2025-07-07
Ukraine Sanctions Russian Crypto Networks in Major Crackdown on War Financing Foreign firms from Cyprus, Kazakhstan, and the UAE also appear on Ukraines sanctions list, alongside 55 Russian companies. By Decrypt 2025-07-07
BTC ATH WEEKLY, AMERICA PARTY LAUNCHES, LETSBONK FLIPS PUMPFUN BTC highest weekly close ever. DOGE leads top 10, BTC dominance falls to 65. Whale moves 4.35b BTC out of 8.7b holding. Public firms bought 131k BTC … By Decrypt 2025-07-07
Gate CEO: From 30M Global Users To A ‘Next-Generation Crypto Exchange’ Dr. Han said regulation, AI and real-world integration will be key themes as the crypto exchange gears up for the next 30 million users. By Decrypt 2025-07-07
Burn the tokens, keep the loot: Play-to-own games come next !Burn the tokens, keep the loot Play-to-own games come nextimagesnewsburn-the-tokens-keep-the-loot-play-to-own-games-coba1a0fa0a20c.jpg The collapse … By Cointelegraph 2025-07-07
BONK Meme Coin Launchpad Flips Pump.fun for Solana Tokens Created The Solana meme coin launchpad wars have reached boiling point as LetsBonk flips Pump.fun for daily tokens created. By Decrypt 2025-07-07
Europe’s Blockchain Group, UK’s Smarter Web Co. add to Bitcoin stashes !Europes Blockchain Group, UKs Smarter Web Co. add to Bitcoin stashesimagesnewseuropes-blockchain-group-uks-smarter-web-co-add-to3ad3638e29ce.jpg … By Cointelegraph 2025-07-07
Toncoin’s TON Crashes as UAE Shoots Down 'Golden Visa' for Stakers Claims TON spiked and then sharply declined following confusion about the visa program, which enables holders to live and work in the UAE. By Decrypt 2025-07-07
Shenzhen issues warning on stablecoin scams, illegal crypto fundraising !Shenzhen issues warning on stablecoin scams, illegal crypto fundraisingimagesnewsshenzhen-issues-warning-on-stablecoin-scams-illegab4127029e15a.jpg … By Cointelegraph 2025-07-07
Strategy to raise $4.2B as Q2 unrealized Bitcoin gains hit $14B !Strategy to raise 4.2B as Q2 unrealized Bitcoin gains hit 14Bimagesnewsstrategy-to-raise-4-2b-as-q2-unrealized-bitcoin-ga1b2c46905d5e.jpg Michael … By Cointelegraph 2025-07-07
Dogecoin, Solana, Ethereum Drive Crypto Markets Higher as Bitcoin Stays Flat DOGE rallied Monday after billionaire fan Elon Musk made headlines with the launch of his pro-Bitcoin America Party. By Decrypt 2025-07-07
LetsBonk flips PumpFun in 24-hour revenue: DefiLlama !LetsBonk flips PumpFun in 24-hour revenue DefiLlamaimagesnewsletsbonk-flips-pumpfun-in-24-hour-revenue-defillame5e9e3d92878.jpg Solanas newest … By Cointelegraph 2025-07-07
Elon Musk Declares Fiat ‘Hopeless,’ Says America Party Will Embrace Bitcoin The multi-billionaires new political outfit positions Bitcoin as a fiscal reform tool, reshaping the crypto policy debate. By Decrypt 2025-07-07
How Bhutan plans to boost its local economy with crypto tourism !How Bhutan plans to boost its local economy with crypto tourismimagesnewshow-bhutan-plans-to-boost-its-local-economy-with-c530222874dcf.jpg Damcho … By Cointelegraph 2025-07-07
Metaplanet adds 2,204 Bitcoin for $237M, now holds 15,555 BTC !Metaplanet adds 2,204 Bitcoin for 237M, now holds 15,555 BTCimagesnewsmetaplanet-adds-2204-bitcoin-for-237m-now-holds-1575e8dba4dd0b.jpg Japans … By Cointelegraph 2025-07-07
Bitcoin Bollinger Bands reach critical point ahead of 'upside breakout' !Bitcoin Bollinger Bands reach critical point ahead of upside breakoutimagesnewsbitcoin-bollinger-bands-reach-critical-point-ahead087afada7614.jpg A … By Cointelegraph 2025-07-07
Crypto funds post $1B inflows with net assets breaking new highs !Crypto funds post 1B inflows with net assets breaking new highsimagesnewscrypto-funds-post-1b-inflows-with-net-assets-breakd3950c199ca5.jpg Bitcoin … By Cointelegraph 2025-07-07
‘False move’ to $105K? 5 things to know in Bitcoin this week !False move to 105K? 5 things to know in Bitcoin this weekimagesnewsfalse-move-to-105k-5-things-to-know-in-bitcoin-thie6aa8167fa1c.jpg Bitcoin sets … By Cointelegraph 2025-07-07
Elon Musk confirms new ‘America Party’ will embrace Bitcoin !Elon Musk confirms new America Party will embrace Bitcoinimagesnewselon-musk-confirms-new-america-party-will-embrace-27e7b0c466ca.jpg Elon Musk … By Cointelegraph 2025-07-07
UK sentences 2 men to prison over $2M cold-calling crypto scam !UK sentences 2 men to prison over 2M cold-calling crypto scamimagesnewsuk-sentences-2-men-to-prison-over-2m-cold-calling-9c6ae543b566.jpg Two men … By Cointelegraph 2025-07-07
Russia targets crypto mining energy thieves, tax dodgers !Russia targets crypto mining energy thieves, tax dodgersimagesnewsrussia-targets-crypto-mining-energy-thieves-tax-do85a8262ee261.jpg Deputy Energy … By Cointelegraph 2025-07-07
Bitcoin eyes new high on tariff deadline, Musk love: Analysts !Bitcoin eyes new high on tariff deadline, Musk love Analystsimagesnewsbitcoin-eyes-new-high-on-tariff-deadline-musk-love499e8601bb75.jpg Bitcoin … By Cointelegraph 2025-07-07
Jack Dorsey tests Bitchat — decentralized messaging without internet !Jack Dorsey tests Bitchat decentralized messaging without internetimagesnewsjack-dorsey-tests-bitchat-decentralized-messaging-5f8cf784d592.jpg … By Cointelegraph 2025-07-07
Trump says Musk ‘off the rails’ for forming political party to rival GOP !Trump says Musk off the rails for forming political party to rival GOPimagesnewstrump-says-musk-off-the-rails-for-forming-politica2dd1d42cd5c6.jpg … By Cointelegraph 2025-07-07
TON coin dips 6% after UAE authorities deny golden visa claim !TON coin dips 6 after UAE authorities deny golden visa claimimagesnewston-coin-dips-6-after-uae-authorities-deny-golden-bbe2b8d78b8d.jpg Emirates … By Cointelegraph 2025-07-07
This Week in Crypto Games: Planetside Dev's 'Reaper Actual', What's Next for 'MapleStory Universe' EverQuest and Planetside co-creator John Smedley reveals NFT game Reaper Actual, whats ahead for MapleStory Universe, and more. By Decrypt 2025-07-06
‘Is this real?’ CZ questions TON’s UAE Golden Visa as gov’t sources stay silent !Is this real? CZ questions TONs UAE Golden Visa as govt sources stay … By Cointelegraph 2025-07-06
VC Roundup: DeFi, AI, hybrid exchanges showcase resilient month for crypto !VC Roundup DeFi, AI, hybrid exchanges showcase resilient month for … By Cointelegraph 2025-07-06
Elon Musk and Dogecoin: How the Billionaire Became the 'Dogefather' Dogecoin was once a joke, but the meme coin gained traction after Elon Musk backed itthen he led DOGE under Trump. Heres a look back. By Decrypt 2025-07-06
You Can Earn Bitcoin By Playing These Free Games Looking to stack some sats without paying a penny? These free games reward you with real Bitcoin for playing. By Decrypt 2025-07-06
Crypto adoption will be driven by high-growth markets, with or without the US !Crypto adoption will be driven by high-growth markets, with or without the … By Cointelegraph 2025-07-06
Bitcoin 'cup and handle' breakout gives $230K target as SOL eyes 2800% gain !Bitcoin cup and handle breakout gives 230K target as SOL eyes 2800 gainimagesnewsbitcoin-cup-and-handle-breakout-gives-230k-target-439845e39af0.jpg … By Cointelegraph 2025-07-06
Vitalik proposes gas cap to enhance Ethereum security, stability !Vitalik proposes gas cap to enhance Ethereum security, stabilityimagesnewsvitalik-proposes-gas-cap-to-enhance-ethereum-securbe47fad62bd3.jpg Vitalik … By Cointelegraph 2025-07-06
TON offers 10-year UAE golden visa for $100K in staked Toncoin !TON offers 10-year UAE golden visa for 100K in staked Toncoinimagesnewston-offers-10-year-uae-golden-visa-for-100k-in-sta139f892c8f70.jpg TON … By Cointelegraph 2025-07-06
Secret Service seizes $400M in crypto, cold wallet among world’s largest !Secret Service seizes 400M in crypto, cold wallet among worlds largestimagesnewssecret-service-seizes-400m-in-crypto-cold-wallet-a7f2787871f5d.jpg … By Cointelegraph 2025-07-06
$8.6B Bitcoin whale transfer shows no signs of sell-off: Arkham !8.6B Bitcoin whale transfer shows no signs of sell-off Arkhamimagesnews8-6b-bitcoin-whale-transfer-shows-no-signs-of-sell0254ada839c4.jpg Arkham … By Cointelegraph 2025-07-06
Taxing Bitcoin ‘doesn’t make a ton of sense’ — Fund manager !Taxing Bitcoin doesnt make a ton of sense Fund managerimagesnewstaxing-bitcoin-doesnt-make-a-ton-of-sense-fund-mandfcf826494c0.jpg Fund manager … By Cointelegraph 2025-07-06
Drake mentions Bitcoin in new song 'What Did I Miss?' !Drake mentions Bitcoin in new song What Did I Miss?imagesnewsdrake-mentions-bitcoin-in-new-song-what-did-i-miss42b15b1c735c.jpg References to … By Cointelegraph 2025-07-05
Mercado Bitcoin announces tokenization of $200M in RWAs on XRPL !Mercado Bitcoin announces tokenization of 200M in RWAs on XRPLimagesnewsmercado-bitcoin-announces-tokenization-of-200m-in-b386ffc9833d.jpg Tokenized … By Cointelegraph 2025-07-05
Crypto’s path to legitimacy runs through the CARF regulation !Cryptos path to legitimacy runs through the CARF regulationimagesnewscryptos-path-to-legitimacy-runs-through-the-carf-rc543cd106c65.jpg The CARF … By Cointelegraph 2025-07-05
Tokenized equity still in regulatory grey zone — Attorneys !Tokenized equity still in regulatory grey zone Attorneysimagesnewstokenized-equity-still-in-regulatory-grey-zone-attc182f7a09e9c.jpg The nascent … By Cointelegraph 2025-07-05
The XRP signal that preceded 25% average drops in 2025 flashes again !The XRP signal that preceded 25 average drops in 2025 flashes againimagesnewsthe-xrp-signal-that-preceded-25-average-drops-in-2cc9ee6097de4.jpg XRP … By Cointelegraph 2025-07-05
Gold Explorer Joins Bitcoin Treasury Bandwagon The early-stage gold explorers Bitcoin reserve strategy has become a familiar playbook among financially pressured firms. By Decrypt 2025-07-05
Bitcoin miners gambled on AI last year, and it paid off !Bitcoin miners gambled on AI last year, and it paid offimagesnewsbitcoin-miners-gambled-on-ai-last-year-and-it-paid0ec034298bb0.jpg When mining got … By Cointelegraph 2025-07-05
DeFi, TradFi convergence could arrive sooner than expected: JPMorgan !DeFi, TradFi convergence could arrive sooner than expected JPMorganimagesnewsdefi-tradfi-convergence-could-arrive-sooner-than-e51a365a3b01e.jpg … By Cointelegraph 2025-07-05
Hong Kong prepares third batch of tokenized bonds, eyes more offerings !Hong Kong prepares third batch of tokenized bonds, eyes more offeringsimagesnewshong-kong-prepares-third-batch-of-tokenized-bonds-1497ea26cf05.jpg … By Cointelegraph 2025-07-05
Robinhood’s 24/7 tokenization push threatens NYSE revenues: Galaxy Digital !Robinhoods 247 tokenization push threatens NYSE revenues Galaxy Digitalimagesnewsrobinhoods-24-7-tokenization-push-threatens-nyse-r8e886f5e760d.jpg … By Cointelegraph 2025-07-05
OKX CEO apologizes after ‘false positives’ lock users out of accounts !OKX CEO apologizes after false positives lock users out of accountsimagesnewsokx-ceo-apologizes-after-false-positives-lock-user5f4f79dae867.jpg The … By Cointelegraph 2025-07-05
‘Small possibility’ $8.6B Bitcoin transfer was a hack: Coinbase exec !Small possibility 8.6B Bitcoin transfer was a hack Coinbase execimagesnewssmall-possibility-8-6b-bitcoin-transfer-was-a-hack46b7d72b31e0.jpg The … By Cointelegraph 2025-07-05
Bitcoin treasury playbook faces ‘far shorter lifespan’ — Analyst !Bitcoin treasury playbook faces far shorter lifespan Analystimagesnewsbitcoin-treasury-playbook-faces-far-shorter-lifespaf7d02becc3a.jpg Crypto … By Cointelegraph 2025-07-05
Bitcoin price falls to $107K despite $1B spot BTC ETF inflow — What’s behind the move? !Bitcoin price falls to 107K despite 1B spot BTC ETF inflow Whats behind the … By Cointelegraph 2025-07-04
Brazil’s central bank service provider hacked, $140M stolen !Brazils central bank service provider hacked, 140M stolenimagesnewsbrazils-central-bank-service-provider-hacked-140m-7ed9112685f2.jpg The theft … By Cointelegraph 2025-07-04
Bitcoin Dives on OG Whale FUD, But Charts Remain Bullish: Analysis A dormant Bitcoin whale woke up and chose violenceby spooking skittish BTC traders with an 8 billion move. The charts though? They tell a different … By Decrypt 2025-07-04
Sweden’s justice minister says to ‘turn up the pressure’ on crypto seizures !Swedens justice minister says to turn up the pressure on crypto seizuresimagesnewsswedens-justice-minister-says-to-turn-up-the-press53b402e5c57c.jpg … By Cointelegraph 2025-07-04
Russian Arms Maker Wants Its Own Stablecoin Too—On Tron Russian state-owned manufacturing firm Rostec has said it will roll out a ruble-pegged token called RUBx on Tron. And a payments platform to boot. By Decrypt 2025-07-04
Crypto Biz: Peter Thiel eyes the SVB throne !Crypto Biz Peter Thiel eyes the SVB throneimagesnewscrypto-biz-peter-thiel-eyes-the-svb-throned05ad64f05ce.jpg Peter Thiel and other billionaires … By Cointelegraph 2025-07-04
Another Solo Bitcoin Miner Beats the Odds, Winning $350K Jackpot The lucky solo Bitcoin miner processed a block with a reward of 3.137 BTC, or 349,028, late Thursday night. By Decrypt 2025-07-04
Bitcoin hits resistance at $110K, but BNB, SOL, LINK, AAVE show promise !Bitcoin hits resistance at 110K, but BNB, SOL, LINK, AAVE show promiseimagesnewsbitcoin-hits-resistance-at-110k-but-bnb-sol-link-a65640ce4a0ee.jpg … By Cointelegraph 2025-07-04
How a Hacker Spent Only $2.7K to Steal $140 Million From Brazilian Banks The hackers laundered roughly 40 million worth of the stolen funds using Bitcoin, Ethereum, and Tether, according to a blockchain investigator. By Decrypt 2025-07-04
Bitcoin retail investor demand is not gone; they’re piling into the spot BTC ETFs !Bitcoin retail investor demand is not gone theyre piling into the spot BTC … By Cointelegraph 2025-07-04
Turkish authorities block PancakeSwap in crackdown on crypto websites !Turkish authorities block PancakeSwap in crackdown on crypto websitesimagesnewsturkish-authorities-block-pancakeswap-in-crackdown15ff151a445d.jpg … By Cointelegraph 2025-07-04
US Senator Lummis’s crypto tax relief plan fuels DeFi momentum: Finance Redefined !US Senator Lummiss crypto tax relief plan fuels DeFi momentum Finance … By Cointelegraph 2025-07-04
Sweden Orders Police to Increase Seizures of Criminal Crypto Profits Swedens Minister of Justice has called on the authorities to make greater use of forfeiture legislation to seize cryptocurrency. By Decrypt 2025-07-04
Ethereum’s comeback strategy — Foundation exec reveals what’s next !Ethereums comeback strategy Foundation exec reveals whats nextimagesnewsethereums-comeback-strategy-foundation-exec-reveal8d44069818fc.jpg In an … By Cointelegraph 2025-07-04
World Liberty Financial publishes proposal to make token transferable !World Liberty Financial publishes proposal to make token transferableimagesnewsworld-liberty-financial-publishes-proposal-to-make026079465425.jpg … By Cointelegraph 2025-07-04
Chimpers Expands Into NFT-Linked Blind Box Collectibles After amassing millions of social followers, Ethereum NFT project Chimpers is expanding into the physical world with plush collectibles. By Decrypt 2025-07-04
Ethereum DeFi Project Ondo Aims to Take on Robinhood With Jump Into Tokenized Stocks The decentralized finance platform is one of several entrants in the crowded tokenized real-world assets market, which is projected to be worth a few … By Decrypt 2025-07-04
DOGE double-bottom pattern hints at price rebound to $0.25 !DOGE double-bottom pattern hints at price rebound to 0.25imagesnewsdoge-double-bottom-pattern-hints-at-price-rebound-9f976a38e60c.jpg A bullish … By Cointelegraph 2025-07-04
Mysterious Bitcoin Whale Moves $8 Billion in 'Largest Daily' Transfer of Old BTC in History The sudden movements of the crypto fortune left analysts befuddled. By Decrypt 2025-07-04
Ondo Finance acquires SEC-registered broker-dealer, eyes tokenized securities !Ondo Finance acquires SEC-registered broker-dealer, eyes tokenized … By Cointelegraph 2025-07-04
Can ChatGPT predict Bitcoin’s next move? !Can ChatGPT predict Bitcoins next move?imagesnewscan-chatgpt-predict-bitcoins-next-move434bb82e4d0a.jpg While its not built for real-time calls, … By Cointelegraph 2025-07-04
Cheaper NFTs Mean Sales Are Surging, But Trading Volume is Plummeting: DappRadar A huge jump in NFT transactions may be linked to OpenSeas upcoming airdrop of the SEA token, a new DappRadar report suggests. By Decrypt 2025-07-04
Bitcoin loses $108K as 14-year-old BTC sparks Satoshi rumors !Bitcoin loses 108K as 14-year-old BTC sparks Satoshi rumorsimagesnewsbitcoin-loses-108k-as-14-year-old-btc-sparks-satos77b1fe7551c7.jpg Bitcoin is … By Cointelegraph 2025-07-04
Unified liquidity enables the first permissionless long-tail leverage market !Unified liquidity enables the first permissionless long-tail leverage … By Cointelegraph 2025-07-04
How a $123M crypto scam in Australia laundered millions through a ‘legit’ business !How a 123M crypto scam in Australia laundered millions through a legit … By Cointelegraph 2025-07-04
FTX estate asks court to freeze payouts in ‘restricted’ countries !FTX estate asks court to freeze payouts in restricted countriesimagesnewsftx-estate-asks-court-to-freeze-payouts-in-restricb3af733f6d09.jpg FTXs … By Cointelegraph 2025-07-04
You Can Buy a Martian Meteorite With Bitcoin—If You Have Upwards of $4 Million Sothebys will auction massive Martian meteorite NWA 16788, and is accepting Bitcoin, Ethereum, and USDC bids for a piece of the red planet. By Decrypt 2025-07-04
Binance taps ex-Gemini exec Gillian Lynch to reboot Europe push !Binance taps ex-Gemini exec Gillian Lynch to reboot Europe pushimagesnewsbinance-taps-ex-gemini-exec-gillian-lynch-to-rebood0158af31580.jpg Binance … By Cointelegraph 2025-07-04
Solana bot scam on GitHub steals crypto from users !Solana bot scam on GitHub steals crypto from usersimagesnewssolana-bot-scam-on-github-steals-crypto-from-userse1b9d8325f0c.jpg A fake GitHub … By Cointelegraph 2025-07-04
Esports Giant Ninjas in Pyjamas Buys Bitcoin Miners, Expects Monthly Production of $6.5M in BTC NIP Group, the parent company of esports organization Ninjas in Pyjamas, is hoping to mine 60 BTC a month, worth approximately 6.5 million. By Decrypt 2025-07-04
Who’s winning the West’s crypto regulation race? !Whos winning the Wests crypto regulation race?imagesnewswhos-winning-the-wests-crypto-regulation-race0be28ce88d59.jpg In the latest episode of … By Cointelegraph 2025-07-04
Crypto Draining Fake Wallet Extensions Flood Firefox Store The FoxyWallet malware campaign saw more than 40 malicious extensions impersonating legitimate crypto wallets on the Firefox Add-ons store. By Decrypt 2025-07-04
Bitcoin to benefit from Trump’s ‘Big Beautiful Bill,’ analysts predict !Bitcoin to benefit from Trumps Big Beautiful Bill, analysts predictimagesnewsbitcoin-to-benefit-from-trumps-big-beautiful-bill-d2795a388f84.jpg … By Cointelegraph 2025-07-04
Oregon AG Seeks to Block Coinbase Bid to Move Securities Case to Federal Court Coinbase called Oregons lawsuit a regulatory land grab, but the state says its a quintessential state law action. By Decrypt 2025-07-04
Multibillion-dollar HODL: Bitcoin whales awaken after 14 years !Multibillion-dollar HODL Bitcoin whales awaken after 14 yearsimagesnewsmultibillion-dollar-hodl-bitcoin-whales-awaken-afta17c55aa031d.jpg Bitcoin … By Cointelegraph 2025-07-04
Altcoins XRP, SOL, DOGE Slump as Trump Reignites Trade Tensions, Passes ‘Big, Beautiful Bill’ Altcoins are down after U.S. President Donald Trump announced plans to send letters to trading partners setting out tariff rates. By Decrypt 2025-07-04
How to buy a home with a crypto-backed loan !How to buy a home with a crypto-backed loanimagesnewshow-to-buy-a-home-with-a-crypto-backed-loan93962a5b2b34.jpg Discover platforms offering … By Cointelegraph 2025-07-04
Bitcoin's third flop at $110K puts bulls at risk: BTC price levels to watch !Bitcoins third flop at 110K puts bulls at risk BTC price levels to watchimagesnewsbitcoin-s-third-flop-at-110k-puts-bulls-at-risk-bt6eac4bfda626.jpg … By Cointelegraph 2025-07-04
Phoenix FIRE investors allege exit scam; owner moves to dismiss case !Phoenix FIRE investors allege exit scam owner moves to dismiss caseimagesnewsphoenix-fire-investors-allege-exit-scam-owner-move4dbeb2db61fc.jpg … By Cointelegraph 2025-07-04
Bitcoin price can hit $150K in weeks thanks to Trump’s ‘Big Beautiful Bill’ !Bitcoin price can hit 150K in weeks thanks to Trumps Big Beautiful Billimagesnewsbitcoin-price-can-hit-150k-in-weeks-thanks-to-trum1498703566fd.jpg … By Cointelegraph 2025-07-04
Bitcoin ETF Inflows Surge Past $600 Million for First Time Since May BlackRocks IBIT and Fidelitys FBTC led Thursdays inflows as investors repositioned around Trumps tax bill and shifting market conditions. By Decrypt 2025-07-04
Belgian court sentences three in kidnapping of crypto investor’s wife !Belgian court sentences three in kidnapping of crypto investors wifeimagesnewsbelgian-court-sentences-three-in-kidnapping-of-cry2460bcdf9c9c.jpg … By Cointelegraph 2025-07-04
How Zelenskyy's ‘suit’ became the center of a massive Polymarket fight !How Zelenskyys suit became the center of a massive Polymarket fightimagesnewshow-zelenskyy-s-suit-became-the-center-of-a-massivbce24b357cc0.jpg … By Cointelegraph 2025-07-04
$20M crypto scam victim who sued Citibank says 2 more banks liable !20M crypto scam victim who sued Citibank says 2 more banks liableimagesnews20m-crypto-scam-victim-who-sued-citibank-says-2-moa0ab6b13d3a3.jpg The … By Cointelegraph 2025-07-04
Solana treasury firm extends stock rally after buying $2.7M of SOL !Solana treasury firm extends stock rally after buying 2.7M of SOLimagesnewssolana-treasury-firm-extends-stock-rally-after-buyc705886d6395.jpg The … By Cointelegraph 2025-07-04
Bitcoin solo miner banks $350K with 2.3 petahash in ‘incredible odds’ !Bitcoin solo miner banks 350K with 2.3 petahash in incredible oddsimagesnewsbitcoin-solo-miner-banks-350k-with-2-3-petahash-in5ed4e29796ab.jpg A … By Cointelegraph 2025-07-04
Bitcoin bull run could peter out in 2-3 months, says analyst !Bitcoin bull run could peter out in 2-3 months, says analystimagesnewsbitcoin-bull-run-could-peter-out-in-2-3-months-sayd760056f2328.jpg Crypto … By Cointelegraph 2025-07-04
US Republicans declare ‘Crypto Week’ to mull 3 crypto bills !US Republicans declare Crypto Week to mull 3 crypto billsimagesnewsus-republicans-declare-crypto-week-to-mull-3-crypta59339a58c1c.jpg US Republican … By Cointelegraph 2025-07-04
Chinese firm completes first buy in effort to stockpile 10% of BNB !Chinese firm completes first buy in effort to stockpile 10 of BNBimagesnewschinese-firm-completes-first-buy-in-effort-to-stocff4a06c77f7e.jpg … By Cointelegraph 2025-07-04
Detroit Sues Crypto Real Estate Platform Over Safety, Health Violations The city alleges the asset tokenization platform left hundreds of properties in disrepair, even as it promised significant returns. By Decrypt 2025-07-04
Bitcoin must hold above $108K or risk a bearish spiral !Bitcoin must hold above 108K or risk a bearish spiralimagesnewsbitcoin-must-hold-above-108k-or-risk-a-bearish-spi59b10da92b93.jpg A crypto analyst … By Cointelegraph 2025-07-04
UK and Singapore Forge New AI and Tokenization Pact in London Talks Officials are exploring cooperation in digital finance, ranging from asset tokenization to artificial intelligence. By Decrypt 2025-07-04
Bitcoin miner production falls in June on power curtailment, weather !Bitcoin miner production falls in June on power curtailment, weatherimagesnewsbitcoin-miner-production-falls-in-june-on-power-cu685bc4c9d910.jpg … By Cointelegraph 2025-07-04
Japan's Minna Bank Explores Stablecoins on Solana in Fireblocks-Led Study The study will examine whether stablecoins are suitable for modernizing payments and cross-border finance in Japan. By Decrypt 2025-07-04
House GOP Declares ‘Crypto Week’ to Advance Landmark Digital Asset Bills House Republicans are coordinating a legislative blitz to reshape U.S. crypto regulation and block future state-issued digital currencies. By Decrypt 2025-07-04
Telegram's Crypto Ecosystem Notches Billion-Dollar Unicorn in The Open Platform A key player in the Telegram-linked The Open Network TON crypto ecosystem just hit a 1 billion valuation with its latest funding round. By Decrypt 2025-07-03
WhiteRock founder to be extradited over $30M ZKasino case — ZachXBT !WhiteRock founder to be extradited over 30M ZKasino case ZachXBTimagesnewswhiterock-founder-to-be-extradited-over-30m-zkasinbdb0aab55363.jpg … By Cointelegraph 2025-07-03
Bitcoin Bullish Again? Potential All-Time High in Sight: Analysis Traders are gearing up for potential 4th of July fireworks as Bitcoin pops past 110,000 ahead of the holidaythough bearish vibes linger. By Decrypt 2025-07-03
Grayscale Calls SEC Trading Pause on ETF Holding Solana, XRP 'Unexpected' The crypto asset manager attributed the decision to a fast-changing regulatory landscape. By Decrypt 2025-07-03
$250M Ondo Catalyst fund signals ‘arms race’ for RWA tokenization !250M Ondo Catalyst fund signals arms race for RWA tokenizationimagesnews250m-ondo-catalyst-fund-signals-arms-race-for-rwa-c835823532fa.jpg Ondo … By Cointelegraph 2025-07-03
ETH traders target $3.2K after ‘golden cross’ debut, derivatives data disagrees !ETH traders target 3.2K after golden cross debut, derivatives data … By Cointelegraph 2025-07-03
Will GPT-5 Be the Surprise Hit of the Summer? Here's What to Expect OpenAIs new flagship model GPT-5 is nearly here. Industry insiders say it could be a game-changeror just another overhyped upgrade. By Decrypt 2025-07-03
Bitcoin price aims for new highs but ‘divergences’ set $110K as resistance !Bitcoin price aims for new highs but divergences set 110K as resistanceimagesnewsbitcoin-price-aims-for-new-highs-but-divergences-sc5f1add51c00.jpg … By Cointelegraph 2025-07-03
Tornado Cash co-founder keeps testimony plans unclear ahead of trial !Tornado Cash co-founder keeps testimony plans unclear ahead of trialimagesnewstornado-cash-co-founder-keeps-testimony-plans-uncl4aceb85d63e0.jpg … By Cointelegraph 2025-07-03
BitMine Trading Halted Twice as Ethereum Treasury Firm Soars Investors who participated in BitMines private placement paid 4.50 per share, but they cant sell their shares yet. By Decrypt 2025-07-03
Trump's 'Big Beautiful Bill' Passes—And Bitcoin Could Fall to $90K, Says Arthur Hayes BitMEX founder Arthur Hayes is still bullish on Bitcoin, but he thinks the coin could briefly dive following the impact of Trumps bill. By Decrypt 2025-07-03
XRP news update: Ripple bank license application, chart pattern fuel potential rally to $2.65 !XRP news update Ripple bank license application, chart pattern fuel potential rally to … By Cointelegraph 2025-07-03
Bitcoin Tax Exemptions May Be Coming After All—In New Senate Bill Sen. Cynthia Lummis R-WY introduced a bill Thursday that would codify many crypto tax perks industry leaders were hoping to include in President … By Decrypt 2025-07-03
Bitcoin mining stocks post double-digit gains in weekly rally !Bitcoin mining stocks post double-digit gains in weekly rallyimagesnewsbitcoin-mining-stocks-post-double-digit-gains-in-w2426fd16a377.jpg The mining … By Cointelegraph 2025-07-03
US Senator Cynthia Lummis drafts standalone crypto tax bill !US Senator Cynthia Lummis drafts standalone crypto tax billimagesnewsus-senator-cynthia-lummis-drafts-standalone-crypto0aa653cc4e1a.jpg The Wyoming … By Cointelegraph 2025-07-03
Leverage without letting go: How Bitcoin can unlock real-world freedom !Leverage without letting go How Bitcoin can unlock real-world freedomimagesnewsleverage-without-letting-go-how-bitcoin-can-unlockeaa88569a1e8.jpg … By Cointelegraph 2025-07-03
ETH news update: Will expanding corporate Ether treasuries send price to $2.8K? !ETH news update Will expanding corporate Ether treasuries send price to … By Cointelegraph 2025-07-03
Bitstamp granted MAS license to operate in Singapore !Bitstamp granted MAS license to operate in Singaporeimagesnewsbitstamp-granted-mas-license-to-operate-in-singapobba83df66d42.jpg The license was … By Cointelegraph 2025-07-03
Bitcoin holding $109K proves bulls control the market: Will new highs happen today? !Bitcoin holding 109K proves bulls control the market Will new highs happen … By Cointelegraph 2025-07-03
16 billion passwords leaked. Is it finally time for blockchain-based digital identity? !16 billion passwords leaked. Is it finally time for blockchain-based digital … By Cointelegraph 2025-07-03
IRS division failed to meet standards for seizing crypto, says watchdog !IRS division failed to meet standards for seizing crypto, says watchdogimagesnewsirs-division-failed-to-meet-standards-for-seizing-0cbb0f558b16.jpg … By Cointelegraph 2025-07-03
BTC TOUCHES $110K, ETH LEADS MAJORS, OPENAI REFUTES TOKENISED STOCK BTC nears ATH, touches 110k. ETH leads broad crypto rally in altcoins. Committed to advancing tokenisation SEC Chair. Institutions buying, big whales … By Decrypt 2025-07-03
Amundi warns GENIUS Act could backfire, undermining dollar dominance !Amundi warns GENIUS Act could backfire, undermining dollar dominanceimagesnewsamundi-warns-genius-act-could-backfire-undermininga1dbdd9b2bee.jpg … By Cointelegraph 2025-07-03
What are address poisoning attacks in crypto and how to avoid them? !What are address poisoning attacks in crypto and how to avoid them?imagesnewswhat-are-address-poisoning-attacks-in-crypto-and-h0f1d37973784.jpg … By Cointelegraph 2025-07-03
XRP futures OI jumps 30% as price chart ‘pennant’ targets $3.20 !XRP futures OI jumps 30 as price chart pennant targets 3.20imagesnewsxrp-futures-oi-jumps-30-as-price-chart-pennant-tar8f1e6dfa15ea.jpg XRPs price … By Cointelegraph 2025-07-03
Bitcoin Seesaws as Hot Jobs Report Extinguishes Rate Cut Hopes The price of Bitcoin wavered after a hotter-than-expected jobs report pointed to a resilient U.S. labor market, squashing rate cut hopes. By Decrypt 2025-07-03
Fix AI’s data theft problem with onchain attribution !Fix AIs data theft problem with onchain attributionimagesnewsfix-ais-data-theft-problem-with-onchain-attributio0443783bbf44.jpg AI models generate … By Cointelegraph 2025-07-03
Quantum computers could bring lost Bitcoin back to life: Here’s how !Quantum computers could bring lost Bitcoin back to life Heres howimagesnewsquantum-computers-could-bring-lost-bitcoin-back-tofb461239a895.jpg … By Cointelegraph 2025-07-03
Bitcoin Consortium Targets Thai Public Firm in Treasury Strategy Push A group led by Metaplanet backers seeks to acquire DV8 on Thailands stock exchange, expanding Bitcoin-on-balance-sheet into Southeast Asia. By Decrypt 2025-07-03
Gate Alpha’s Points Carnival Changes How Crypto Users Access Airdrops Two seasons, a 33-day campaign. Over 100,000 participants. 800,000 in rewardsand a third wave now underway. By Decrypt 2025-07-03
Bitcoin dices with $110K as US jobs beat takes Fed rate cut 'off table' !Bitcoin dices with 110K as US jobs beat takes Fed rate cut off tableimagesnewsbitcoin-dices-with-110k-as-us-jobs-beat-takes-fed-7f8cd393d06c.jpg … By Cointelegraph 2025-07-03
Pakistan Bitcoin mining plan in limbo as IMF rejects power subsidies: Report !Pakistan Bitcoin mining plan in limbo as IMF rejects power subsidies … By Cointelegraph 2025-07-03
MiCA enforcement still fragmented across EU, says Bitpanda exec !MiCA enforcement still fragmented across EU, says Bitpanda execimagesnewsmica-enforcement-still-fragmented-across-eu-says-bb890acca2161.jpg … By Cointelegraph 2025-07-03
Bitcoin price rallied 80% the last time BTC funding rates flipped red !Bitcoin price rallied 80 the last time BTC funding rates flipped redimagesnewsbitcoin-price-rallied-80-the-last-time-btc-funding2d41ecd0e673.jpg A … By Cointelegraph 2025-07-03
Moo Deng Surges As Viral Pygmy Hippo’s Birthday Plans Revealed by Zoo Viral pygmy hippo Moo Deng will turn one next weekand crypto degens are pumping her unofficial Solana meme coin. By Decrypt 2025-07-03
Why can’t Bitcoin price break $112K all-time highs? BTC analysts explain !Why cant Bitcoin price break 112K all-time highs? BTC analysts explainimagesnewswhy-cant-bitcoin-price-break-112k-all-time-highs-bc825c8d6ad01.jpg … By Cointelegraph 2025-07-03
EverQuest, Planetside Co-Creator Reveals Open-World Shooter Game 'Reaper Actual' John Smedley believes his new studios ambitious shooter Reaper Actual will sell gamers on blockchain, because it is Web3 done right. By Decrypt 2025-07-03
John Smedley’s studio raises $30.5M for new shooter built on Etherlink !John Smedleys studio raises 30.5M for new shooter built on Etherlinkimagesnewsjohn-smedleys-studio-raises-30-5m-for-new-shooter-29df37d123b5.jpg … By Cointelegraph 2025-07-03
India’s ‘Most Prolific Darknet Drug Syndicate’ Used Monero to Evade Cops A 35-year-old Kerala native allegedly shipped drugs nationwide while laundering proceeds through privacy crypto Monero, officials say. By Decrypt 2025-07-03
ChatGPT vs X: Which is better at first spotting the next big crypto narrative? !ChatGPT vs X Which is better at first spotting the next big crypto … By Cointelegraph 2025-07-03
$280 Million in Crypto Shorts Liquidated as Bitcoin Tops $110K BTC short liquidations topped 101 million as the leading cryptocurrency touched 110,000 Thursday morning. By Decrypt 2025-07-03
Bitcoin Suisse legal chief flags gaps in EU, Swiss stablecoin rules !Bitcoin Suisse legal chief flags gaps in EU, Swiss stablecoin rulesimagesnewsbitcoin-suisse-legal-chief-flags-gaps-in-eu-swiss-9f848dffbf1c.jpg … By Cointelegraph 2025-07-03
Crypto theft campaign hits Firefox users with wallet clones !Crypto theft campaign hits Firefox users with wallet clonesimagesnewscrypto-theft-campaign-hits-firefox-users-with-wall601f703692a3.jpg Over 40 fake … By Cointelegraph 2025-07-03
IMF Rejects Pakistan’s Bid to Subsidise Power for Crypto Mining The IMF hasnt agreed to crypto power subsidies yet, but Pakistan is working with the World Bank and others to refine the plan. By Decrypt 2025-07-03
JD.com, Ant Group push yuan stablecoins to challenge US dollar dominance !JD.com, Ant Group push yuan stablecoins to challenge US dollar dominanceimagesnewsjd-com-ant-group-push-yuan-stablecoins-to-challeng60e65fb69c66.jpg … By Cointelegraph 2025-07-03
Tether USDT challenges Circle’s lead on BitPay payments in 2025 !Tether USDT challenges Circles lead on BitPay payments in 2025imagesnewstether-usdt-challenges-circles-lead-on-bitpay-paym35d50e482866.jpg USDC … By Cointelegraph 2025-07-03
DOJ recovers $40K crypto from Trump-Vance inaugural scam, credits Tether !DOJ recovers 40K crypto from Trump-Vance inaugural scam, credits Tetherimagesnewsdoj-recovers-40k-crypto-from-trump-vance-inaugurald1171ccc5808.jpg … By Cointelegraph 2025-07-03
Why Real Creativity Still Needs Chaos and a Human Touch in the AI Age French philosopher Gilles Deleuze once argued art emerges from chaos. Now, his critique is finding new relevance in an AI-generated world. By Decrypt 2025-07-03
Ethereum Community Foundation forms with ‘mandate’ for $10K ETH !Ethereum Community Foundation forms with mandate for 10K ETHimagesnewsethereum-community-foundation-forms-with-mandate-f2f9a9a7d67ed.jpg Ethereum … By Cointelegraph 2025-07-03
TradFi body urges SEC reject special treatment for tokenized stocks !TradFi body urges SEC reject special treatment for tokenized stocksimagesnewstradfi-body-urges-sec-reject-special-treatment-forfd181616e718.jpg A … By Cointelegraph 2025-07-03
US probes negotiator suspected of taking crypto ransomware money !US probes negotiator suspected of taking crypto ransomware moneyimagesnewsus-probes-negotiator-suspected-of-taking-crypto-ra23ce1055049e.jpg … By Cointelegraph 2025-07-03
North Korean hackers targeting crypto projects with unusual Mac exploit !North Korean hackers targeting crypto projects with unusual Mac exploitimagesnewsnorth-korean-hackers-targeting-crypto-projects-wite122a36f1e62.jpg … By Cointelegraph 2025-07-03
Bitcoin may tap $116K in July amid ‘perfect storm’ of macro catalysts !Bitcoin may tap 116K in July amid perfect storm of macro catalystsimagesnewsbitcoin-may-tap-116k-in-july-amid-perfect-storm-of9b2ddccfd9dc.jpg A … By Cointelegraph 2025-07-03
Scammer Posed as Trump-Vance Official to Steal $250K in Crypto, DOJ Says The FBI has traced some of the stolen crypto through blockchain analytics and recovered over 40,000 with help from Tether. By Decrypt 2025-07-03
Bitcoin aims for new highs as BTC futures activity highlights paradigm shift !Bitcoin aims for new highs as BTC futures activity highlights paradigm … By Cointelegraph 2025-07-03
First Solana staking ETF hits $12M in ‘healthy’ first trading day !First Solana staking ETF hits 12M in healthy first trading dayimagesnewsfirst-solana-staking-etf-hits-12m-in-healthy-firste897e2b03dc5.jpg … By Cointelegraph 2025-07-03
BlackRock Bitcoin ETF earns more than its flagship S&P 500 fund !BlackRock Bitcoin ETF earns more than its flagship SP 500 fundimagesnewsblackrock-bitcoin-etf-earns-more-than-its-flagship00156660ead7.jpg … By Cointelegraph 2025-07-03
Crypto billionaire bit off kidnapper’s finger during ambush: Report !Crypto billionaire bit off kidnappers finger during ambush Reportimagesnewscrypto-billionaire-bit-off-kidnappers-finger-durind14213c95a11.jpg Crypto … By Cointelegraph 2025-07-03
Inside the Controversy Brewing Over Robinhood’s Tokenized Stocks Robinhoods tokenized stocks drew fire from the ChatGPT maker and critics who say the product offers no real equity and lacks transparency. By Decrypt 2025-07-03
Ripple applies for US banking license, joining crypto rush for legitimacy !Ripple applies for US banking license, joining crypto rush for … By Cointelegraph 2025-07-03
Bitcoin rallies to $109.7K but pro traders question BTC’s price momentum !Bitcoin rallies to 109.7K but pro traders question BTCs price momentumimagesnewsbitcoin-rallies-to-109-7k-but-pro-traders-questionf9f65509509a.jpg … By Cointelegraph 2025-07-02
OpenAI says Robinhood tokens are not equity in the company !OpenAI says Robinhood tokens are not equity in the companyimagesnewsopenai-says-robinhood-tokens-are-not-equity-in-the9d34c36ae831.jpg The platforms … By Cointelegraph 2025-07-02
Is Zohran Mamdani really that bad for New York’s crypto industry? !Is Zohran Mamdani really that bad for New Yorks crypto industry?imagesnewsis-zohran-mamdani-really-that-bad-for-new-yorks-cr69cc1f9063ba.jpg Zohran … By Cointelegraph 2025-07-02
Solana Staking ETF Bags $12M in Wall Street Debut The SEC is expected to approve several Solana-focused ETFs this year, but the Rex-Osprey Solana Staking ETF is the first in the U.S. By Decrypt 2025-07-02
Peter Thiel, Tech Billionaires to Form Bank for Crypto, AI Startups The proposed bank, called Ererbor, will service firms in crypto, defense, AI and other sectors that have historically been barred from working with … By Decrypt 2025-07-02
Ethereum, Dogecoin Soar as Bitcoin Hits Highest Price in 3 Weeks Bitcoin came close to a return to 110,000 on Wednesday as major altcoins like Ethereum and Dogecoin put up larger gains. By Decrypt 2025-07-02
Crypto should be about freeing people, not esoteric tech — Vitalik Buterin !Crypto should be about freeing people, not esoteric tech Vitalik … By Cointelegraph 2025-07-02
LTC under $90: Buying opportunity or warning sign? !LTC under 90 Buying opportunity or warning sign?imagesnewsltc-under-90-buying-opportunity-or-warning-signf17706c8e894.jpg LTC price fell under 90, … By Cointelegraph 2025-07-02
SEC Hits Pause on Grayscale's XRP, Solana and Cardano ETF Conversion Though the agency greenlit the partially altcoin-exposed ETF this week, it also paused the approval until further notice. By Decrypt 2025-07-02
SEC ends ‘regulation through enforcement,’ calls tokenization 'innovation' !SEC ends regulation through enforcement, calls tokenization innovationimagesnewssec-ends-regulation-through-enforcement-calls-tokeadc86583396b.jpg … By Cointelegraph 2025-07-02
This App Alerts You to ICE Raids—Now Trump's DOJ Wants It Gone ICE-tracking app ICEBlock has sparked backlash from the DOJ and DHS, along with legal threats over federal agents safety concerns. By Decrypt 2025-07-02
BNB news update: Bulls target $719 after successful Maxwell upgrade !BNB news update Bulls target 719 after successful Maxwell upgradeimagesnewsbnb-news-update-bulls-target-719-after-successful-a09b1a3cf15e.jpg BNB … By Cointelegraph 2025-07-02
Solana Treasury Firm DeFi Development Corp. Boosts Convertible Notes Offering to $112 Million Shares of DeFi Development Corp. DFDV finished the day down by 3 following its upsized convertible notes offering to buy more Solana. By Decrypt 2025-07-02
Cake Wallet onboards dEURO decentralized stablecoin, offers 10% yield on collateral !Cake Wallet onboards dEURO decentralized stablecoin, offers 10 yield on … By Cointelegraph 2025-07-02
Will Bitcoin benefit from ‘Big Beautiful Bill’ passage and US debt ceiling increase? !Will Bitcoin benefit from Big Beautiful Bill passage and US debt ceiling … By Cointelegraph 2025-07-02
Crypto Billionaire Bit Off Attacker’s Finger in Attempted Kidnapping: Report Billionaire investor and entrepreneur Tim Heath shared his experience amid a growing trend of wrench attacks against crypto holders. By Decrypt 2025-07-02
SOL news update: REX Shares Solana ETF boosts price, but for how long? !SOL news update REX Shares Solana ETF boosts price, but for how long?imagesnewssol-news-update-rex-shares-solana-etf-boosts-price838bac97a190.jpg … By Cointelegraph 2025-07-02
Bitcoin and Ethereum Bounce, But This Meme Coin Is Stealing the Show: Analysis Bitcoin and Ethereum prices are showing signs of life, but for traders with high-risk appetites, an underdog meme coin is flashing bullish signs. By Decrypt 2025-07-02
Researchers Use AI to Reconstruct 3,000-Year-Old Babylonian Hymn The Hymn of Babylon had been lost for over 2,000 yearsuntil researchers used AI to piece it together from 30 clay fragments. By Decrypt 2025-07-02
Bitcoin’s STH cost basis suggests $117K is the next stop for BTC price !Bitcoins STH cost basis suggests 117K is the next stop for BTC priceimagesnewsbitcoins-sth-cost-basis-suggests-117k-is-the-next-f3715e5af7c3.jpg … By Cointelegraph 2025-07-02
Trump’s crypto ventures have added $620M to his net worth — Report !Trumps crypto ventures have added 620M to his net worth Reportimagesnewstrumps-crypto-ventures-have-added-620m-to-his-net-b5861512f126.jpg With the … By Cointelegraph 2025-07-02
Ripple Follows Circle in Bid for US Banking License Crypto payments firm Ripple said Wednesday that it has applied for a national bank charter from the OCC, just days after Circle did the same. By Decrypt 2025-07-02
Bitcoin Headed for 'Best Ever' Second Half of the Year: Standard Chartered Bitcoin could hit new highs in the second half of this year, as institutional treasury buying breaks historical post-halving patterns. By Decrypt 2025-07-02
Bitcoin price target ‘sits around $170K’ as global M2 supply reaches record high !Bitcoin price target sits around 170K as global M2 supply reaches record … By Cointelegraph 2025-07-02
Peter Thiel backs crypto-friendly Silicon Valley Bank rival — Report !Peter Thiel backs crypto-friendly Silicon Valley Bank rival Reportimagesnewspeter-thiel-backs-crypto-friendly-silicon-valley-bec2e30f2ae3d.jpg … By Cointelegraph 2025-07-02
Judge Says $4 Billion Celsius Lawsuit Against Tether Can Proceed Bankrupt Celsius wins right to pursue 4B lawsuit against Tether over alleged improper liquidation of 39,500 Bitcoin held as loan collateral. By Decrypt 2025-07-02
ETH news update: Ether rangebreak possible due to spot ETF inflows !ETH news update Ether rangebreak possible due to spot ETF inflowsimagesnewseth-news-update-ether-rangebreak-possible-due-to-s0e18dd4755fa.jpg ETH … By Cointelegraph 2025-07-02
Tether made $5.2B in 2024: Here’s how stablecoins make money !Tether made 5.2B in 2024 Heres how stablecoins make moneyimagesnewstether-made-5-2b-in-2024-heres-how-stablecoins-mak922f1081572f.jpg With rising … By Cointelegraph 2025-07-02
The crypto revolution remains half-built !The crypto revolution remains half-builtimagesnewsthe-crypto-revolution-remains-half-builtac54a805ef2a.jpg Despite surging crypto adoption in … By Cointelegraph 2025-07-02
Brazil’s 17.5% crypto tax: How the new rules hurt small investors most !Brazils 17.5 crypto tax How the new rules hurt small investors mostimagesnewsbrazils-17-5-crypto-tax-how-the-new-rules-hurt-sma481c6636959c.jpg … By Cointelegraph 2025-07-02
Bitcoin squeezes shorts in $108K spike as US jobs drop most in 2 years !Bitcoin squeezes shorts in 108K spike as US jobs drop most in 2 yearsimagesnewsbitcoin-squeezes-shorts-in-108k-spike-as-us-jobs-dbfabe650a0d3.jpg … By Cointelegraph 2025-07-02
UK Pension Firm Sees Growing Interest in Bitcoin Exposure Cartwright Pension Trusts helped a pioneering pension scheme to secure returns of about 60 from its BTC allocation in under a year. By Decrypt 2025-07-02
Coinbase Acquires Token Management Platform LiquiFi as Exchange Aims to Expand Its Services The acquisition, the fifth this year for the exchange, will help early-stage projects, Coinbase said in a blog post. By Decrypt 2025-07-02
KBC Bank to offer Bitcoin, Ether to retail customers !KBC Bank to offer Bitcoin, Ether to retail customersimagesnewskbc-bank-to-offer-bitcoin-ether-to-retail-customer014ddcf62c0e.jpg Belgiums KBC Bank … By Cointelegraph 2025-07-02
Wimbledon Stars Lead 'Flappy Racquet' Telegram Game Ahead of SCOR Token Launch Flappy Racquet puts a tennis twist on Flappy Bird, implementing Wimbledon stars as playable NFT characters ahead of the SCOR airdrop. By Decrypt 2025-07-02
PancakeSwap doubles quarterly volume to $530B as upgrades boost growth !PancakeSwap doubles quarterly volume to 530B as upgrades boost growthimagesnewspancakeswap-doubles-quarterly-volume-to-530b-as-up41868b479fd2.jpg … By Cointelegraph 2025-07-02
Euro stablecoin by DWS and Deutsche Bank gets regulatory approval !Euro stablecoin by DWS and Deutsche Bank gets regulatory approvalimagesnewseuro-stablecoin-by-dws-and-deutsche-bank-gets-regude72bff9f621.jpg … By Cointelegraph 2025-07-02
Binance Pay brings crypto payments to 80+ French Riviera merchants !Binance Pay brings crypto payments to 80 French Riviera merchantsimagesnewsbinance-pay-brings-crypto-payments-to-80-french-riaef0712442e2.jpg … By Cointelegraph 2025-07-02
Coinbase acquires token management platform Liquifi !Coinbase acquires token management platform Liquifiimagesnewscoinbase-acquires-token-management-platform-liquif1a0b3cab4d46.jpg Coinbases … By Cointelegraph 2025-07-02
Bitcoin traders adopt ‘defensive stance’ as 15-day ETF inflow streak ends !Bitcoin traders adopt defensive stance as 15-day ETF inflow streak endsimagesnewsbitcoin-traders-adopt-defensive-stance-as-15-day-e5045ae28ce1d.jpg … By Cointelegraph 2025-07-02
ECB to pilot blockchain-based euro settlement system by 2026 !ECB to pilot blockchain-based euro settlement system by 2026imagesnewsecb-to-pilot-blockchain-based-euro-settlement-syst8699a6d2b00a.jpg The … By Cointelegraph 2025-07-02
Bitcoin ETFs Shed $342 Million As 15-Day Streak Ends With the Fed signaling it will maintain its restrictive monetary policy stance, investors are rethinking their exposure to Bitcoin ETFs. By Decrypt 2025-07-02
Bybit, OKX expand crypto services in Europe under MiCA !Bybit, OKX expand crypto services in Europe under MiCAimagesnewsbybit-okx-expand-crypto-services-in-europe-under-m6ce847d60ab3.jpg Bybit and OKX … By Cointelegraph 2025-07-02
Standard Chartered expects Bitcoin to hit new highs of $135K in Q3 !Standard Chartered expects Bitcoin to hit new highs of 135K in Q3imagesnewsstandard-chartered-expects-bitcoin-to-hit-new-highd0449e87dbae.jpg The … By Cointelegraph 2025-07-02
Bitcoin profit-taking makes $140K key BTC price point: Research !Bitcoin profit-taking makes 140K key BTC price point Researchimagesnewsbitcoin-profit-taking-makes-140k-key-btc-price-poi0bfe14b51109.jpg Bitcoin … By Cointelegraph 2025-07-02
Judge lets Celsius $4B Bitcoin lawsuit against Tether move forward !Judge lets Celsius 4B Bitcoin lawsuit against Tether move forwardimagesnewsjudge-lets-celsius-4b-bitcoin-lawsuit-against-tethe0f5fb3608e9.jpg A US … By Cointelegraph 2025-07-02
Binance CEO on how Bhutan’s happiness philosophy aligns with crypto !Binance CEO on how Bhutans happiness philosophy aligns with cryptoimagesnewsbinance-ceo-on-how-bhutans-happiness-philosophy-al51c3a6a3db1f.jpg … By Cointelegraph 2025-07-02
OFAC Sanctions Russian Hosting Provider for Enabling Crypto Theft The U.S. Treasury has targeted a Russian firm linked to ransomware, infostealers, and darknet drug markets involving crypto. By Decrypt 2025-07-02
Why On-Chain Metrics Miss the Full Picture of Institutional Bitcoin Buying Bitcoin hit a record monthly close in June, but experts say on-chain data is missing the scale of institutional demand via ETFs and OTC desks. By Decrypt 2025-07-02
Design app Figma discloses $70M Bitcoin ETF holdings in IPO filing !Design app Figma discloses 70M Bitcoin ETF holdings in IPO filingimagesnewsdesign-app-figma-discloses-70m-bitcoin-etf-holding66ebee6b820a.jpg Figma … By Cointelegraph 2025-07-02
5 ‘insidious’ crypto scams to watch out for this year !5 insidious crypto scams to watch out for this yearimagesnews5-insidious-crypto-scams-to-watch-out-for-this-yeaa0ab6b13d3a3.jpg Crypto hacking … By Cointelegraph 2025-07-02
Arizona Governor Yet Again Rejects Bitcoin Reserve Using Seized Crypto Mounting crypto-related vetoes point to the states cautious approach, but a future governor could hold an opposing view, Decrypt was told. By Decrypt 2025-07-02
Bitcoin’s ‘super-majority’ holds $1.2T in unrealized profits: Glassnode !Bitcoins super-majority holds 1.2T in unrealized profits Glassnodeimagesnewsbitcoins-super-majority-holds-1-2t-in-unrealized-p8a8a32161598.jpg … By Cointelegraph 2025-07-02
Crypto losses hit $2.5B in first half of 2025, but hacks fall in Q2: CertiK !Crypto losses hit 2.5B in first half of 2025, but hacks fall in Q2 … By Cointelegraph 2025-07-02
Arizona governor vetoes bill to stockpile seized crypto !Arizona governor vetoes bill to stockpile seized cryptoimagesnewsarizona-governor-vetoes-bill-to-stockpile-seized-cda6571c017f1.jpg Arizona Governor … By Cointelegraph 2025-07-02
Crypto sentiment holds steady as Bitcoin drops to $105K !Crypto sentiment holds steady as Bitcoin drops to 105Kimagesnewscrypto-sentiment-holds-steady-as-bitcoin-drops-to-6f69a2220847.jpg Despite Bitcoins … By Cointelegraph 2025-07-02
New York AG urges Congress to bolster protections in crypto bills !New York AG urges Congress to bolster protections in crypto billsimagesnewsnew-york-ag-urges-congress-to-bolster-protections-faf795b39ed5.jpg … By Cointelegraph 2025-07-02
US sanctions crypto wallet tied to ransomware, infostealer host !US sanctions crypto wallet tied to ransomware, infostealer hostimagesnewsus-sanctions-crypto-wallet-tied-to-ransomware-infoafec79110126.jpg The US … By Cointelegraph 2025-07-02
Figma Eyes Further Bitcoin Exposure in Run-Up to Hopeful NYSE Debut Figmas 69.5 million Bitcoin ETF holding now accounts for 4.5 of its cash and securities portfolio, the company revealed Tuesday. By Decrypt 2025-07-02
Paging Dr. Algorithm: Microsoft’s AI Diagnoses Like House, Bills Like Costco In head-to-head tests, Microsofts virtual medical council diagnosed correctly four times more often than human doctors, and at a lower cost. By Decrypt 2025-07-01
Hotels Are Staffing Robots—and Guests Are Freaking Out Hotels are turning to humanoid robots, with guests either loving or hating the creepy, human-like experience. By Decrypt 2025-07-01
Cloudflare Hits the Kill Switch on AI Crawlers—And an Entire Industry Cheers The worlds largest internet security provider just defaulted to blocking AI crawlersand lets publishers set a price for scraping. By Decrypt 2025-07-01
High on DOGE? Cannabis Company Makes Dogecoin Treasury Play Publicly traded cannabis company Dogecoin Cash Inc. is embracing the real DOGE after previously stockpiling a derivative meme coin. By Decrypt 2025-07-01
SOL ETF news gain evaporates, while chart warns of another 20% drop !SOL ETF news gain evaporates, while chart warns of another 20 dropimagesnewssol-etf-news-gain-evaporates-while-chart-warns-of-89d3a69cce79.jpg SOL … By Cointelegraph 2025-07-01
SEC approves conversion of Grayscale's large-cap crypto fund into ETF !SEC approves conversion of Grayscales large-cap crypto fund into ETFimagesnewssec-approves-conversion-of-grayscale-s-large-cap-ca44adcf4ed91.jpg … By Cointelegraph 2025-07-01
MARA Bitcoin Production Slides 25% as Mining Environment Toughens The Florida-based firm produced 237 fewer Bitcoin in June compared to the month prior, but said in its latest report that it would increase its … By Decrypt 2025-07-01
Fed Chair Powell Says Trump Policies to Blame for Lack of Rate Cuts Powell said Tuesday that if not for President Trumps aggressive tariff policies, the Fed would have likely already cut interest rates in 2025. By Decrypt 2025-07-01
Why Is Robinhood Building on Arbitrum Instead of Solana? A Kraken spokesperson told Decrypt that the company is working to bring xStocks to chains beyond Solana. By Decrypt 2025-07-01
US regulator considers simplified path to market for crypto ETFs !US regulator considers simplified path to market for crypto ETFsimagesnewsus-regulator-considers-simplified-path-to-market-fa44adcf4ed91.jpg The … By Cointelegraph 2025-07-01
Bitcoin at risk of deeper drop as BTC slips below key support levels !Bitcoin at risk of deeper drop as BTC slips below key support levelsimagesnewsbitcoin-at-risk-of-deeper-drop-as-btc-slips-below-34c66771c4a7.jpg A … By Cointelegraph 2025-07-01
Bitcoin analysts say market quickly absorbs selling, paving way for a bullish July !Bitcoin analysts say market quickly absorbs selling, paving way for a bullish … By Cointelegraph 2025-07-01
Connecticut governor approves law prohibiting crypto use in government !Connecticut governor approves law prohibiting crypto use in governmentimagesnewsconnecticut-governor-approves-law-prohibiting-cryp42ad98929f3f.jpg … By Cointelegraph 2025-07-01
You Can Now Trade Stocks Like NVDA and MSTR on Solana: Here's How It Works Stocks like Nvidia, Tesla, and Strategy are now tokenized on Solana and trading via Kraken and other platforms. Heres what you need to know. By Decrypt 2025-07-01
Hong Kong-Based Food Firm Secures $528 Million to Boost Bitcoin Treasury Publicly traded DDC Enterprise plans to buy 5,000 BTC over the next three years after raising fresh funding to fuel its Bitcoin strategy. By Decrypt 2025-07-01
Swissquote ordered to curb impersonation, fraud attempts !Swissquote ordered to curb impersonation, fraud attemptsimagesnewsswissquote-ordered-to-curb-impersonation-fraud-attdb0634c2dbbd.jpg The company … By Cointelegraph 2025-07-01
Grayscale ETF Holding XRP, Solana and Cardano Receives SEC Green Light The regulator approved Grayscales bid to convert a fund primarily focused on Bitcoin, but also holding other major cryptocurrencies, into an … By Decrypt 2025-07-01
Moon or Doom: Will Bitcoin See Fireworks on July 4? Will Bitcoin close the week above 108,000? The odds on the Myriad prediction market have swung dramatically. By Decrypt 2025-07-01
How to build a Solana DApp for iOS and Android in 15 minutes, no back end needed !How to build a Solana DApp for iOS and Android in 15 minutes, no back end … By Cointelegraph 2025-07-01
XRP news update: Traders predict consolidation to $2.35 amid ETF speculation !XRP news update Traders predict consolidation to 2.35 amid ETF … By Cointelegraph 2025-07-01
Trump’s ‘Big Beautiful Bill’ Passes Senate—Without Bitcoin Tax Exemptions Crypto industry leaders had raced to include provisions in the bill that would have offered crypto miners and retail users key tax benefitsbut the … By Decrypt 2025-07-01
US Senate passes Trump’s budget bill without provision on crypto taxes !US Senate passes Trumps budget bill without provision on crypto taxesimagesnewsus-senate-passes-trumps-budget-bill-without-provisb55c31b7a606.jpg … By Cointelegraph 2025-07-01
MACRO, CRYPTO UNICORNS, ROBINHOOD & NYC TAKEAWAYS XRP, DOGE lead majors with positive funding rates. BTC ETH ETFs extend inflows streak. RexShares SOL staking ETF to go live Wednesday. SEC delays … By Decrypt 2025-07-01
Strategy set to post $13B Bitcoin gains, but revenue stalls !Strategy set to post 13B Bitcoin gains, but revenue stallsimagesnewsstrategy-set-to-post-13b-bitcoin-gains-but-revenue79c04a182733.jpg Michael … By Cointelegraph 2025-07-01
Less than 15% Bitcoin left on crypto exchanges signals ‘supply problem’ !Less than 15 Bitcoin left on crypto exchanges signals supply problemimagesnewsless-than-15-bitcoin-left-on-crypto-exchanges-signa99f6cab2a6a.jpg … By Cointelegraph 2025-07-01
'Reset Button for the Degen Soul': Ethereum L2 Coin Flip Game Pairs Betting With AI-Powered Vibes Betting on a coin flip isnt bad odds when youve spent all day in the meme coin trenchesplus Token Yugijo gives you an AI-powered pal. By Decrypt 2025-07-01
Bitcoin Cash Has Reached a 7-Month High—Analysts Explain the Rally Bitcoin Cash hits 7-month high at 519, up 29 monthly on whale buying spree, but momentum may be cooling as big player activity drops 90. By Decrypt 2025-07-01
Pi news update: Bulls aim to hold $0.47 support as bears reject breakout !Pi news update Bulls aim to hold 0.47 support as bears reject breakoutimagesnewspi-news-update-bulls-aim-to-hold-0-47-support-as-b31e8d2e16905.jpg … By Cointelegraph 2025-07-01
Crypto PAC-backed candidate wins Virginia primary for vacant House seat !Crypto PAC-backed candidate wins Virginia primary for vacant House seatimagesnewscrypto-pac-backed-candidate-wins-virginia-primary-eac56a978da7.jpg … By Cointelegraph 2025-07-01
Coinbase Stock Sags After Dual Blow of Supreme Court Decision, Ark Share Sale Coinbase faces legal setback and 95M selloff but analysts see upside potential and are predicting 1.33 per share gain in Q2 earnings. By Decrypt 2025-07-01
How to set up stop-loss and take-profit orders !How to set up stop-loss and take-profit ordersimagesnewshow-to-set-up-stop-loss-and-take-profit-orders0fe06c1cfbd5.jpg Stop-loss and take-profit … By Cointelegraph 2025-07-01
$324M in fees and no roadmap: What’s really going on with the TRUMP memecoin? !324M in fees and no roadmap Whats really going on with the TRUMP memecoin? … By Cointelegraph 2025-07-01
BTC RECORD MONTHLY CLOSE, TOKENISED STOCK TRADING BLOOMS, STAKING ETFS COMING XRP, DOGE lead majors with positive funding rates. BTC ETH ETFs extend inflows streak. RexShares SOL staking ETF to go live Wednesday. SEC delays … By Decrypt 2025-07-01
Crypto hacks are a wake-up call for DeFi !Crypto hacks are a wake-up call for DeFiimagesnewscrypto-hacks-are-a-wake-up-call-for-defi5916dbcf51ee.jpg Crypto hacks underscore the urgent need … By Cointelegraph 2025-07-01
Moody’s brings credit ratings onchain via Solana, explained !Moodys brings credit ratings onchain via Solana, explainedimagesnewsmoodys-brings-credit-ratings-onchain-via-solana-exd3fe0f5e5ae9.jpg Moodys and … By Cointelegraph 2025-07-01
FATF’s crypto checklist hints at the next regulatory crackdown !FATFs crypto checklist hints at the next regulatory crackdownimagesnewsfatfs-crypto-checklist-hints-at-the-next-regulator4ee65d9039eb.jpg The FATF … By Cointelegraph 2025-07-01
XRP price predictions above $3 in 2025 have one major flaw !XRP price predictions above 3 in 2025 have one major flawimagesnewsxrp-price-predictions-above-3-in-2025-have-one-majc843cd0b1785.jpg XRP remains at … By Cointelegraph 2025-07-01
Bitcoin Layer-2 Network Botanix Launches Mainnet, Touts Decentralization 'From the Start' Botanix, a Bitcoin layer-2 blockchain, launched its mainnet Tuesday as it attempts to bring more DeFi capabilities to the BTC network. By Decrypt 2025-07-01
Competition heats up as crypto exchanges vie for European market !Competition heats up as crypto exchanges vie for European marketimagesnewscompetition-heats-up-as-crypto-exchanges-vie-for-eb67cba1e744e.jpg … By Cointelegraph 2025-07-01
Kraken, Robinhood-backed MiCA-compliant Global Dollar stablecoin lands in EU !Kraken, Robinhood-backed MiCA-compliant Global Dollar stablecoin lands in … By Cointelegraph 2025-07-01
UK’s Smarter Web Company adds $24.7M in Bitcoin, now holds 773 BTC !UKs Smarter Web Company adds 24.7M in Bitcoin, now holds 773 BTCimagesnewsuks-smarter-web-company-adds-24-7m-in-bitcoin-now-05c2063ac610.jpg Smarter … By Cointelegraph 2025-07-01
Deutsche Bank to launch crypto custody accounts in 2026: Report !Deutsche Bank to launch crypto custody accounts in 2026 Reportimagesnewsdeutsche-bank-to-launch-crypto-custody-accounts-inea1ca3978782.jpg Deutsche … By Cointelegraph 2025-07-01
Feds Charge Man With $1.7M Scheme to Convert Fake Checks Into Bitcoin The alleged scheme involved laundering the proceeds of counterfeit checks and business email compromise scams into Bitcoin. By Decrypt 2025-07-01
Bitcoin due to copy S&P 500 to hit new all-time high in July: Forecast !Bitcoin due to copy SP 500 to hit new all-time high in July Forecastimagesnewsbitcoin-due-to-copy-s-p-500-to-hit-new-all-time-hie8edd19128f9.jpg … By Cointelegraph 2025-07-01
Elon Musk’s xAI raises $10B as Trump threatens to unleash DOGE on him !Elon Musks xAI raises 10B as Trump threatens to unleash DOGE on himimagesnewselon-musks-xai-raises-10b-as-trump-threatens-to-una0892c4276c1.jpg Elon … By Cointelegraph 2025-07-01
Bitcoin targets $200K as profit metrics enter ‘cautiously optimistic’ zone !Bitcoin targets 200K as profit metrics enter cautiously optimistic zoneimagesnewsbitcoin-targets-200k-as-profit-metrics-enter-cauti3a3c82f77fa3.jpg … By Cointelegraph 2025-07-01
Bitget Wallet Launches Crypto-Linked Mastercard in Partnership with Immersve The card will initially launch in the UK and the European Union, before rolling out later in Latin America, Australia and New Zealand. By Decrypt 2025-07-01
Australia’s Swyftx to Acquire Caleb & Brown in Record $66M Plus ANZ Crypto Deal Swyftx is acquiring Caleb Brown in the largest crypto MA deal in ANZ as it seeks a foothold in the U.S. to target high-net-worth clients. By Decrypt 2025-07-01
Malaysian regulator proposes easing crypto asset listing process !Malaysian regulator proposes easing crypto asset listing processimagesnewsmalaysian-regulator-proposes-easing-crypto-asset-l5412bf4efd46.jpg … By Cointelegraph 2025-07-01
FATF warning on stablecoin crimes is not anti-crypto, intel firms say !FATF warning on stablecoin crimes is not anti-crypto, intel firms sayimagesnewsfatf-warning-on-stablecoin-crimes-is-not-anti-cryp0a6351b19d18.jpg … By Cointelegraph 2025-07-01
Trump Threatens to Turn DOGE Against Former Chief Elon Musk Trump has escalated his feud with Musk, suggesting DOGE scrutinize the billions in subsidies supporting the business magnates companies. By Decrypt 2025-07-01
Centrifuge brings S&P 500 onchain in tokenized fund launch !Centrifuge brings SP 500 onchain in tokenized fund launchimagesnewscentrifuge-brings-s-p-500-onchain-in-tokenized-fun65f5708d75bd.jpg Centrifuge … By Cointelegraph 2025-07-01
Ubisoft Adds AI Agents to ‘Captain Laserhawk’ Game That Vote and Govern Blockchain game Captain Laserhawk The G.A.M.E. is integrating AI agents that can make governance decisions on behalf of players. By Decrypt 2025-07-01
DOJ charges 4 North Koreans in $1M crypto theft from blockchain startup !DOJ charges 4 North Koreans in 1M crypto theft from blockchain startupimagesnewsdoj-charges-4-north-koreans-in-1m-crypto-theft-fro6bb24383c26a.jpg … By Cointelegraph 2025-07-01
Katana’s mainnet debuts with $200M in active DeFi deposits !Katanas mainnet debuts with 200M in active DeFi depositsimagesnewskatanas-mainnet-debuts-with-200m-in-active-defi-ded389a961e15d.jpg Katana, a new … By Cointelegraph 2025-07-01
Trump’s Big Beautiful Bill in overtime as senators jam crypto clauses !Trumps Big Beautiful Bill in overtime as senators jam crypto clausesimagesnewstrumps-big-beautiful-bill-in-overtime-as-senators-b3f1d6983b69.jpg US … By Cointelegraph 2025-07-01
Hut 8 Raises $220 Million as Trump-Linked Crypto Projects Forge Deeper Ties With UAE A new Dubai office will house a team focused on trading and comes as the mining firm clinches hundreds of millions of dollars. By Decrypt 2025-07-01
Major German bank to offer crypto trading by 2026 amid bank ‘FOMO’ !Major German bank to offer crypto trading by 2026 amid bank FOMOimagesnewsmajor-german-bank-to-offer-crypto-trading-by-2026-5abce8ed4527.jpg … By Cointelegraph 2025-07-01
Trump-linked American Bitcoin raises $220M for mining, treasury !Trump-linked American Bitcoin raises 220M for mining, treasuryimagesnewstrump-linked-american-bitcoin-raises-220m-for-mini1fe2e9a58e69.jpg The raise … By Cointelegraph 2025-07-01
Bitcoin sets record monthly close at $107K as analyst tips 9% rally !Bitcoin sets record monthly close at 107K as analyst tips 9 rallyimagesnewsbitcoin-sets-record-monthly-close-at-107k-as-analydc58d14e1dbd.jpg … By Cointelegraph 2025-07-01
DOJ Charge Fake North Korean Devs 'Embedding' In Crypto Startups Federal prosecutors claim DPRK agents infiltrated a blockchain startup under false identities, pushing code to drain funds. By Decrypt 2025-07-01
Bitcoin ‘vertical acceleration’ off the table for now: Bitfinex !Bitcoin vertical acceleration off the table for now Bitfineximagesnewsbitcoin-vertical-acceleration-off-the-table-for-no7641a1f42d38.jpg Bitfinex … By Cointelegraph 2025-07-01
Analysts raise chance of SOL, XRP and LTC ETF approval to 95% !Analysts raise chance of SOL, XRP and LTC ETF approval to 95imagesnewsanalysts-raise-chance-of-sol-xrp-and-ltc-etf-approb530f9610998.jpg Crypto ETF … By Cointelegraph 2025-07-01
TradFi could move onchain due to ‘horrible banking experiences’ !TradFi could move onchain due to horrible banking experiencesimagesnewstradfi-could-move-onchain-due-to-horrible-banking-0c41424d9d8a.jpg Aave Labs … By Cointelegraph 2025-07-01
Circle applies for US trust bank charter to manage its USDC reserve !Circle applies for US trust bank charter to manage its USDC reserveimagesnewscircle-applies-for-us-trust-bank-charter-to-manage7d98a4ee5af5.jpg … By Cointelegraph 2025-07-01
Rex-Osprey Solana ETF to Debut 'First-Ever' US Crypto Fund With Staking Rex Shares and Osprey Funds is set to launch the first U.S. ETF offering direct Solana exposure with staking rewards. By Decrypt 2025-07-01
Mark Zuckerberg Unveils New Meta AI Lab After Poaching OpenAI Talent Meta is throwing huge bucks to lure away top talent in the high-stakes AI race, prompting the company to give its employees the week off to cool down. By Decrypt 2025-06-30
SOL price rallies to $161 after ETF news, but is the rally sustainable? !SOL price rallies to 161 after ETF news, but is the rally sustainable?imagesnewssol-price-rallies-to-161-after-etf-news-but-is-the171bd228e76a.jpg … By Cointelegraph 2025-06-30
Solana Advisor Nikita Bier Joins Elon Musk's X, Reigniting Crypto Payments Speculation Biers announcement is fueling speculation about Xs future crypto payment plans, including long-rumored Dogecoin integration. By Decrypt 2025-06-30
ETH trading pattern points to 100% rally to $5,000: What are the odds? !ETH trading pattern points to 100 rally to 5,000 What are the odds?imagesnewseth-trading-pattern-points-to-100-rally-to-5000-wh2f9a9a7d67ed.jpg … By Cointelegraph 2025-06-30
Trump Admin Beats Coinbase, Privacy Advocates in Supreme Court IRS Showdown The Supreme Court declined on Monday to hear a case that could have re-examined whether crypto exchanges like Coinbase need to comply with government … By Decrypt 2025-06-30
How GameStop Inspired This Lingerie MMA League to Bet on Bitcoin Lingerie Fighting Championships started to seriously consider Bitcoin as a treasury asset following GameStops recent buy. By Decrypt 2025-06-30
Spanish authorities arrest five people in $541M crypto fraud case !Spanish authorities arrest five people in 541M crypto fraud caseimagesnewsspanish-authorities-arrest-five-people-in-541m-crybdb0aab55363.jpg Europol … By Cointelegraph 2025-06-30
Bitcoin holds steady as major catalysts align for breakout above $110K !Bitcoin holds steady as major catalysts align for breakout above 110Kimagesnewsbitcoin-holds-steady-as-major-catalysts-align-for-35b400a76a75.jpg … By Cointelegraph 2025-06-30
Stablecoin Giant Circle Wants to Be Its Own Bank, Applies for National Trust License Circle is seeking approval from the OCC to establish a national trust bank to oversee its USDC stablecoin reserves. By Decrypt 2025-06-30
What’s Next for 'MapleStory Universe'? More Ways to Play Following the launch of Avalanche game MapleStory N, Nexpace plans on expanding the broader MapleStory Universe in various ways. Heres how. By Decrypt 2025-06-30
Bitcoin ‘demand generation’ phase mirrors 2022 market bottom: Are new highs incoming? !Bitcoin demand generation phase mirrors 2022 market bottom Are new highs … By Cointelegraph 2025-06-30
US Supreme Court will not review IRS case involving Coinbase user data !US Supreme Court will not review IRS case involving Coinbase user dataimagesnewsus-supreme-court-will-not-review-irs-case-involvin01f9bd836672.jpg A … By Cointelegraph 2025-06-30
First US staking ETF to launch Wednesday, giving investors exposure to Solana !First US staking ETF to launch Wednesday, giving investors exposure to … By Cointelegraph 2025-06-30
Price predictions 6/30: SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE !Price predictions 630 SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPEimagesnewsprice-predictions-6-30-spx-dxy-btc-eth-xrp-bnb-sol72400565c689.jpg … By Cointelegraph 2025-06-30
Solana Skyrockets as Bitcoin and Ethereum Grind Higher: Where Do Prices Go Next? Bitcoin and Ethereum are climbing upwards, but Solana is outperforming. Whats next for its price? Heres what the charts say. By Decrypt 2025-06-30
Trump’s 'Big Beautiful Bill' May Get a 'Hail Mary' Bitcoin Tax Exemption The last-minute initiative could add new tax provisions on crypto staking rewards, de minimus capital gains exemptions, and other perks. By Decrypt 2025-06-30
Robinhood Shares Hit All-Time High as Firm Unveils Tokenized Stocks, Ethereum L2 The firm said on Monday that it had secured a MiCA license, allowing it to offer tokenized stock trading to customers on Arbitrum. By Decrypt 2025-06-30
More Bitcoin? Crypto Should Account for Up to 40% of Portfolios, Influential Financial Advisor Says Ric Edelman told Decrypt that even 90-year-olds should consider digital asset investments with an eye toward helping future generations. By Decrypt 2025-06-30
Where are we in the Bitcoin cycle? Analyst Lyn Alden shares her view !Where are we in the Bitcoin cycle? Analyst Lyn Alden shares her viewimagesnewswhere-are-we-in-the-bitcoin-cycle-analyst-lyn-alde303eca77c5e4.jpg … By Cointelegraph 2025-06-30
Iranian Exchange Nobitex Restarts After Bitcoin, Dogecoin and Tron Swiped in $90M Hack Nobitex is slowly restoring its services to verified users, following a 90 million hack from a pro-Israeli hacker group earlier this month. By Decrypt 2025-06-30
Texas makes gold, silver legal tender following governor’s approval !Texas makes gold, silver legal tender following governors approvalimagesnewstexas-makes-gold-silver-legal-tender-following-govf08d97777fc8.jpg … By Cointelegraph 2025-06-30
Robinhood launches layer-2 blockchain for stock trading in Europe !Robinhood launches layer-2 blockchain for stock trading in Europeimagesnewsrobinhood-launches-layer-2-blockchain-for-stock-tr111ff8c60660.jpg … By Cointelegraph 2025-06-30
BitMine Stock Spikes 400% as Bitcoin Miner Raises $250 Million for Ethereum Treasury Publicly traded Bitcoin mining firm BitMine is creating an Ethereum treasury after raising 250 million and adding Tom Lee to its board. By Decrypt 2025-06-30
Watch these XRP levels as price meets ‘turning point’ !Watch these XRP levels as price meets turning pointimagesnewswatch-these-xrp-levels-as-price-meets-turning-poin82ca9ae0c573.jpg XRP price teases a … By Cointelegraph 2025-06-30
Singapore to 'Thread the Needle' as Crypto Licensing Rules Take Effect The deadline has forced firms to flee to Dubai and Hong Kong as Singapore closes a key loophole and prioritizes regulatory integrity. By Decrypt 2025-06-30
JP Morgan Rates Circle ‘Underweight,’ Sets $80 Price Target The company faces headwinds ranging from lower interest rates to the adoption of a CBDC in the EU, JP Morgan analysts wrote. By Decrypt 2025-06-30
BTC STEADY, ROBINHOOD CRYPTO ANNOUNCEMENT TODAY, S&P 500 ATH BTC steady ahead of jobs data, trade deal news. Robinhood to make crypto announcement today. ARB leads altcoins on Robinhood rumours. BTC is great, … By Decrypt 2025-06-30
Bitcoin teases 'brutal' short squeeze as sellers protect $108K !Bitcoin teases brutal short squeeze as sellers protect 108Kimagesnewsbitcoin-teases-brutal-short-squeeze-as-sellers-pro384573bdd848.jpg Bitcoin … By Cointelegraph 2025-06-30
Strategy Continues Bitcoin Shopping Spree With $532 Million BTC Buy The software firm has added another 4,980 Bitcoin to its treasury, bringing its total holdings of the asset to nearly 64 billion at present. By Decrypt 2025-06-30
Circuit unveils recovery system to solve crypto’s ‘permanent loss’ conundrum !Circuit unveils recovery system to solve cryptos permanent loss … By Cointelegraph 2025-06-30
Robinhood Launches Tokenized Stock and Perpetual Futures Trading in Europe The company unveiled several other features for crypto users in the U.S. and Europe. By Decrypt 2025-06-30
Crypto's value lies in bridging the gap between tradition and disruption !Cryptos value lies in bridging the gap between tradition and disruptionimagesnewscrypto-s-value-lies-in-bridging-the-gap-between-trce2f79751709.jpg … By Cointelegraph 2025-06-30
Ten New Wallets Added to WalletConnect Certified Program WalletConnect Certified recognizes projects that offer a world-class user experiencegiving developers a clear framework for excellence. By Decrypt 2025-06-30
How ZachXBT traced a $31M Bitcoin donation to a flagged wallet !How ZachXBT traced a 31M Bitcoin donation to a flagged walletimagesnewshow-zachxbt-traced-a-31m-bitcoin-donation-to-a-flabfefaf4d857f.jpg From Silk … By Cointelegraph 2025-06-30
Ethereum risks 25% price drop as ‘massive whale’ moves $237M in ETH to exchanges !Ethereum risks 25 price drop as massive whale moves 237M in ETH to … By Cointelegraph 2025-06-30
BitMine raises $250M to launch Ethereum corporate treasury !BitMine raises 250M to launch Ethereum corporate treasuryimagesnewsbitmine-raises-250m-to-launch-ethereum-corporate-te3db3f880f88.jpg BitMine … By Cointelegraph 2025-06-30
Bitcoin hashrate down 15%, 26 firms add BTC to balance sheets: June in charts !Bitcoin hashrate down 15, 26 firms add BTC to balance sheets June in … By Cointelegraph 2025-06-30
Tokenized stock trading live on Kraken, Bybit and Solana’s DeFi ecosystem !Tokenized stock trading live on Kraken, Bybit and Solanas DeFi ecosystemimagesnewstokenized-stock-trading-live-on-kraken-bybit-and-s1b4497c486f7.jpg … By Cointelegraph 2025-06-30
Bitcoin’s new all-time high now ‘inevitable’ as BTC price eyes liquidity at $109K !Bitcoins new all-time high now inevitable as BTC price eyes liquidity at … By Cointelegraph 2025-06-30
Strategy buys $531M of Bitcoin as sentiment rebounds above $107K !Strategy buys 531M of Bitcoin as sentiment rebounds above 107Kimagesnewsstrategy-buys-531m-of-bitcoin-as-sentiment-rebound68cdc3286ddf.jpg Michael … By Cointelegraph 2025-06-30
Metaplanet Adds $104M in BTC, Testing Limits of Bitcoin Treasury Plan Metaplanets Bitcoin stash grew by 46,806 BTC in June, fueling both investor excitement and concerns among industry observers. By Decrypt 2025-06-30
Chainlink reveals compliance standard, targets $100T institutional crypto flows !Chainlink reveals compliance standard, targets 100T institutional crypto … By Cointelegraph 2025-06-30
JPMorgan rates Circle underweight with $80 target by late 2026 !JPMorgan rates Circle underweight with 80 target by late 2026imagesnewsjpmorgan-rates-circle-underweight-with-80-target-b7062c6df41ce.jpg While … By Cointelegraph 2025-06-30
Kazakhstan plans to establish national crypto reserve !Kazakhstan plans to establish national crypto reserveimagesnewskazakhstan-plans-to-establish-national-crypto-rese06879516ee25.jpg Kazakhstans … By Cointelegraph 2025-06-30
Spanish Police Dismantle $540 Million 'Crypto Investment Fraud Ring' Five were arrested in connection with the years-long investigation, which involved law enforcement from Spain, Estonia, France and the U.S. By Decrypt 2025-06-30
Crypto ETP inflows in H1 2025 down 2.7% from last year’s $18.3B !Crypto ETP inflows in H1 2025 down 2.7 from last years 18.3Bimagesnewscrypto-etp-inflows-in-h1-2025-down-2-7-from-last-y44e99104c336.jpg Crypto ETPs … By Cointelegraph 2025-06-30
Bhutan embraces crypto payments despite connectivity gaps !Bhutan embraces crypto payments despite connectivity gapsimagesnewsbhutan-embraces-crypto-payments-despite-connectiviad66bbd5675b.jpg Cointelegraph … By Cointelegraph 2025-06-30
Record Q2, monthly close next? 5 things to know in Bitcoin this week !Record Q2, monthly close next? 5 things to know in Bitcoin this weekimagesnewsrecord-q2-monthly-close-next-5-things-to-know-in-b5bc875ba85a9.jpg … By Cointelegraph 2025-06-30
Barclays Joins List of UK Banks Restricting Credit Card Crypto Buys The banks move comes after reports that the Financial Conduct Authority is seeking to ban crypto purchases using credit. By Decrypt 2025-06-30
Hacked Iranian crypto exchange Nobitex slowly restores services !Hacked Iranian crypto exchange Nobitex slowly restores servicesimagesnewshacked-iranian-crypto-exchange-nobitex-slowly-rest64473e654b22.jpg Hacked … By Cointelegraph 2025-06-30
Unlucky trader ‘qwatio’ liquidated 8 times in a week, loses $12.5M !Unlucky trader qwatio liquidated 8 times in a week, loses 12.5Mimagesnewsunlucky-trader-qwatio-liquidated-8-times-in-a-weeke3e5db7c25b8.jpg A trader … By Cointelegraph 2025-06-30
South Korea pauses CBDC tests as stablecoin fever hits banks !South Korea pauses CBDC tests as stablecoin fever hits banksimagesnewssouth-korea-pauses-cbdc-tests-as-stablecoin-fever-91dc3dd00324.jpg The Bank of … By Cointelegraph 2025-06-30
Netflix’s ‘Squid Game’ Creator Compares Rich Villains to Elon Musk The creator says the shows billionaire villains now mirror figures like Elon Musk, as Season 3 sharpens its critique of visible oligarch power. By Decrypt 2025-06-30
Metaplanet surpasses Cleanspark with $108M Bitcoin buy !Metaplanet surpasses Cleanspark with 108M Bitcoin buyimagesnewsmetaplanet-surpasses-cleanspark-with-108m-bitcoin-08fc4686574d.jpg Metaplanet has … By Cointelegraph 2025-06-30
Hong Kong's Upcoming Stablecoin Rules to Shake Up US Dollar Dominance, Deter Bigger Players The city has aligned its fintech push with Chinas de-dollarization efforts as new stablecoin laws take effect in August. By Decrypt 2025-06-30
Why Spanish Vanadi Coffee’s $1.1B Bitcoin Bet Will ‘Likely Fail’ With just six locations and millions in losses, Vanadi is hoping its crypto pivot can lift financials and bolster confidence in its business. By Decrypt 2025-06-30
BNB Smart Chain block times fall to 0.8 secs amid Maxwell upgrade !BNB Smart Chain block times fall to 0.8 secs amid Maxwell upgradeimagesnewsbnb-smart-chain-block-times-fall-to-0-8-secs-amid-8a8bb671077f.jpg BNB … By Cointelegraph 2025-06-30
Bitcoin price stuck as OGs are ‘dumping on Wall Street’: Analyst !Bitcoin price stuck as OGs are dumping on Wall Street Analystimagesnewsbitcoin-price-stuck-as-ogs-are-dumping-on-wall-strac99c0df8aa2.jpg Long-term … By Cointelegraph 2025-06-30
Arbitrum jumps 17% on speculation of partnership with Robinhood !Arbitrum jumps 17 on speculation of partnership with Robinhoodimagesnewsarbitrum-jumps-17-on-speculation-of-partnership-wib2c9d4d69a69.jpg … By Cointelegraph 2025-06-30
Bitcoin Holds Steady as ECB Forum Looms, Traders Gear for Volatility Shift Bitcoin remains rangebound, as options and on-chain data point to rising volatility amid looming macro policy shifts. By Decrypt 2025-06-30
Growing dissatisfaction among young people to drive BTC price: Analyst !Growing dissatisfaction among young people to drive BTC price Analystimagesnewsgrowing-dissatisfaction-among-young-people-to-driv36dd63a3b8b6.jpg … By Cointelegraph 2025-06-29
Bitcoin aims for highest weekly close: Will HYPE, BCH, LINK, and SEI follow? !Bitcoin aims for highest weekly close Will HYPE, BCH, LINK, and SEI … By Cointelegraph 2025-06-29
This Week in Crypto Games: 'Raini: The Lords of Light' Shutting Down, 'Eve Frontier' Trial Avalanche card game Raini The Lords of Light is closing soon, Eve Frontier launched a free trial period, and more. By Decrypt 2025-06-29
Saylor signals impending Bitcoin buy for 11th consecutive week !Saylor signals impending Bitcoin buy for 11th consecutive weekimagesnewssaylor-signals-impending-bitcoin-buy-for-11th-cons1c8576cc0669.jpg Michael … By Cointelegraph 2025-06-29
Bitcoin Alkanes: The Next Big BTC Innovation After Ordinals and Runes? The Alkanes metaprotocol enables the creation of apps, NFTs, and tokens on Bitcoin. Will it fuel a new wave of BTC innovation? By Decrypt 2025-06-29
How mass decoy messaging protects whistleblowers — CoverDrop founder !How mass decoy messaging protects whistleblowers CoverDrop founderimagesnewshow-mass-decoy-messaging-protects-whistleblowers-c86716881010c.jpg The … By Cointelegraph 2025-06-29
The 6 Doomsday Scenarios That Keep AI Experts Up at Night Experts warn the real AI threat is not destruction, but subtle manipulation that makes us surrender willingly. By Decrypt 2025-06-29
The renaissance returns with decentralized AI !The renaissance returns with decentralized AIimagesnewsthe-renaissance-returns-with-decentralized-ai9bc87ad4542a.jpg Decentralized AI breaks open … By Cointelegraph 2025-06-29
The Biggest Games Releasing in July 2025 Julys light on blockbusters, but Switch 2 shines with Donkey Kong Bananza, while Grounded 2 and Ninja Gaiden keep things interesting. By Decrypt 2025-06-29
Stablecoins are becoming ‘default settlement layer’ for internet: Alchemy !Stablecoins are becoming default settlement layer for internet Alchemyimagesnewsstablecoins-are-becoming-default-settlement-layer-19e9447ea04d.jpg … By Cointelegraph 2025-06-29
Ripple vs SEC: Why the XRP Legal Battle Still Isn't Officially Over It hasnt been an easy road to resolution for Ripple and the SEC in the long-running legal fight over XRP sales. Heres why. By Decrypt 2025-06-29
Bitcoin price will make history with $109K weekly, monthly close !Bitcoin price will make history with 109K weekly, monthly closeimagesnewsbitcoin-price-will-make-history-with-109k-weekly-m8f69021f02d9.jpg Bitcoin … By Cointelegraph 2025-06-29
Binance ties to Kenyan crypto board raise monopoly concerns: Report !Binance ties to Kenyan crypto board raise monopoly concerns Reportimagesnewsbinance-ties-to-kenyan-crypto-board-raise-monopolycb2a6453c57e.jpg … By Cointelegraph 2025-06-29
27% of Koreans aged 20–50 hold crypto, 70% eye more investments: Report !27 of Koreans aged 2050 hold crypto, 70 eye more investments Reportimagesnews27-of-koreans-aged-20-50-hold-crypto-70-eye-more-iee9222322631.jpg Over … By Cointelegraph 2025-06-29
Bitcoin is 'bad for dictators': Human Rights Foundation exec !Bitcoin is bad for dictators Human Rights Foundation execimagesnewsbitcoin-is-bad-for-dictators-human-rights-foundati2d80f101a089.jpg Human Rights … By Cointelegraph 2025-06-29
‘All systems go’ for Solana staking ETF to launch any moment: Analysts !All systems go for Solana staking ETF to launch any moment Analystsimagesnewsall-systems-go-for-solana-staking-etf-to-launch-an31f314d362c8.jpg ETF … By Cointelegraph 2025-06-29
Bitcoin takes pressure off the US dollar — US President Trump !Bitcoin takes pressure off the US dollar US President Trumpimagesnewsbitcoin-takes-pressure-off-the-us-dollar-us-presidf5cdae31a72d.jpg Trump … By Cointelegraph 2025-06-28
Can China's MiniMax-M1 AI Topple US Rivals? We Put It to the Test We break down Chinas new open-source reasoning model, MiniMax-M1 real benchmarks, hidden tradeoffs, and how it stacks up against competitors. By Decrypt 2025-06-28
Few Bitcoin treasury companies will survive 'death spiral': VC Report !Few Bitcoin treasury companies will survive death spiral VC Reportimagesnewsfew-bitcoin-treasury-companies-will-survive-death-33bee9c69336.jpg … By Cointelegraph 2025-06-28
Coinbase makes TIME's 100 Most Influential Companies of 2025 list !Coinbase makes TIMEs 100 Most Influential Companies of 2025 listimagesnewscoinbase-makes-time-s-100-most-influential-companie8ea33acd147.jpg The … By Cointelegraph 2025-06-28
Bybit Ethereum Heist Propels Record $2.1 Billion in Crypto Stolen by Hackers So Far in 2025 Around 70 of the 2.1 billion in crypto stolen by hackers in the first six months of 2025 was traced back to North Korea, a new report says. By Decrypt 2025-06-28
'FIFA Rivals' Review: Should You Play This NFT Soccer Game? Following the success of NFL Rivals, Mythical Games is back with FIFA Rivals on iOS and Android. Heres our take on the NFT soccer game. By Decrypt 2025-06-28
Emerging economies have sparked crypto’s most important retail revolution yet !Emerging economies have sparked cryptos most important retail revolution … By Cointelegraph 2025-06-28
How Much Bitcoin Has Iran Mined? It's Complicated Individuals, schools, and mosques in Iran are illegally mining Bitcoin to avoid high bills, making it difficult to estimate BTC holdings. By Decrypt 2025-06-28
Will Solana, XRP, Dogecoin and Other Crypto ETFs Take Off? Analysts are not sure just how well ETFs giving investors exposure to altcoins like XRP, Solana, and Dogecoin would fare if approved. By Decrypt 2025-06-28
Crypto cards outpace banks in micro-spending in Europe: Report !Crypto cards outpace banks in micro-spending in Europe Reportimagesnewscrypto-cards-outpace-banks-in-micro-spending-in-eu755abf1c3946.jpg Crypto … By Cointelegraph 2025-06-28
Vitalik introduces ‘pluralistic’ IDs to protect privacy in digital identity systems !Vitalik introduces pluralistic IDs to protect privacy in digital identity … By Cointelegraph 2025-06-28
How high can XRP price go? !How high can XRP price go?imagesnewshow-high-can-xrp-price-goafaeb3e65242.jpg XRP whale flows flipped positive in May for the first time in months, … By Cointelegraph 2025-06-28
Crypto exchange Bitvavo receives MiCA license from the Netherlands !Crypto exchange Bitvavo receives MiCA license from the Netherlandsimagesnewscrypto-exchange-bitvavo-receives-mica-license-from5b0e23fa1ebf.jpg … By Cointelegraph 2025-06-28
Crypto scammer gets 8 years for $40M eEmpowerCoin, ECoinPlus scams !Crypto scammer gets 8 years for 40M eEmpowerCoin, ECoinPlus scamsimagesnewscrypto-scammer-gets-8-years-for-40m-eempowercoin-e6231e090929b.jpg Dwayne … By Cointelegraph 2025-06-28
XRP spikes 3% after Garlinghouse says Ripple dropping SEC cross-appeal !XRP spikes 3 after Garlinghouse says Ripple dropping SEC cross-appealimagesnewsxrp-spikes-3-after-garlinghouse-says-ripple-droppibe14eef2c7f5.jpg … By Cointelegraph 2025-06-28
Gemini launches tokenized Michael Saylor's Strategy stock for EU investors !Gemini launches tokenized Michael Saylors Strategy stock for EU … By Cointelegraph 2025-06-28
XRP price saw month-long 420% rally the last time this metric turned green !XRP price saw month-long 420 rally the last time this metric turned … By Cointelegraph 2025-06-28
Bitcoin price holds range but needs fresh demand to break higher !Bitcoin price holds range but needs fresh demand to break higherimagesnewsbitcoin-price-holds-range-but-needs-fresh-demand-t774de14a01e8.jpg Bitcoin … By Cointelegraph 2025-06-27
Trump Blames Biden for Banks Blocking Crypto: 'There Is a Lot of Debanking' President Trump unloaded on the issue of crypto debanking Friday, but stopped short of committing to issuing an executive order on the subject. By Decrypt 2025-06-27
Fake IT insiders behind $1M in crypto losses across NFT protocols — ZackXBT !Fake IT insiders behind 1M in crypto losses across NFT protocols … By Cointelegraph 2025-06-27
Here’s what happened in crypto today !Heres what happened in crypto todayimagesnewsheres-what-happened-in-crypto-todaye5e2e67a031a.jpg Need to know what happened in crypto today? Here is … By Cointelegraph 2025-06-27
'Rogue' Police Are Destroying Bitcoin ATMs: Bitcoin Depot Legal Chief Chris Ryan said that police may be breaking the law in some instances and that the provider of the machines is entitled to the funds. By Decrypt 2025-06-27
Crypto backers eye New York City mayoral race as next battleground !Crypto backers eye New York City mayoral race as next battlegroundimagesnewscrypto-backers-eye-new-york-city-mayoral-race-as-n645726dbd0ca.jpg … By Cointelegraph 2025-06-27
Ripple to Drop Appeal in SEC Case Over XRP Sales, Ending Case 'Once and for All' Ripple says itll drop its appeal in the long-running SEC case over XRP sales, finally putting the legal battle to bed. By Decrypt 2025-06-27
Solana ranks second in DEX volumes — Will SOL price follow? !Solana ranks second in DEX volumes Will SOL price follow?imagesnewssolana-ranks-second-in-dex-volumes-will-sol-price-2106bf97b636.jpg Solana … By Cointelegraph 2025-06-27
Aptos sees surge in tokenization as asset managers go onchain !Aptos sees surge in tokenization as asset managers go onchainimagesnewsaptos-sees-surge-in-tokenization-as-asset-managers1269ef7bef5a.jpg Aptos … By Cointelegraph 2025-06-27
Trump sidesteps question on crypto divesting to pass key bills !Trump sidesteps question on crypto divesting to pass key billsimagesnewstrump-sidesteps-question-on-crypto-divesting-to-pad94b12eacce5.jpg Several … By Cointelegraph 2025-06-27
Public Keys: Copycat Lawsuits for Bitcoin Giant Strategy, Coinbase Hits All-Time High Why Bitcoin treasury giant Strategy is facing down multiple identical lawsuits, plus Coinbase hits a record closing price as perps near. By Decrypt 2025-06-27
Bitcoin builds energy for new highs as US stagflation risk, tariff war, Fed rate cuts loom !Bitcoin builds energy for new highs as US stagflation risk, tariff war, Fed rate cuts … By Cointelegraph 2025-06-27
Crypto Biz: Bitcoin, treasuries and the stablecoin surge !Crypto Biz Bitcoin, treasuries and the stablecoin surgeimagesnewscrypto-biz-bitcoin-treasuries-and-the-stablecoin-s0d94edd2c0ae.jpg Corporations … By Cointelegraph 2025-06-27
White House Weighs Federal Land and Fast-Tracked Permits to Drive AI Boom: Reuters President Trump is reportedly mulling executive orders to boost AI infrastructure in the U.S. amid soaring energy demands. By Decrypt 2025-06-27
Price predictions 6/27: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, LINK !Price predictions 627 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, … By Cointelegraph 2025-06-27
Price predictions 6/27: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, LINK !Price predictions 627 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, … By Cointelegraph 2025-06-27
Anchorage ‘Safety Matrix’ faces backlash over stablecoin delistings !Anchorage Safety Matrix faces backlash over stablecoin delistingsimagesnewsanchorage-safety-matrix-faces-backlash-over-stable365d295fb41b.jpg Nick … By Cointelegraph 2025-06-27
Anchorage ‘Safety Matrix’ faces backlash over stablecoin delistings !Anchorage Safety Matrix faces backlash over stablecoin delistingsimagesnewsanchorage-safety-matrix-faces-backlash-over-stable365d295fb41b.jpg Nick … By Cointelegraph 2025-06-27
Moon or Doom: Where Does Bitcoin Go Next, $115K or $95K? Whats next for the price of Bitcoin? Prediction markets show growing bullish sentiment despite technical indicators suggesting caution. By Decrypt 2025-06-27
Bitcoin, XRP, SOL futures launch on Robinhood !Bitcoin, XRP, SOL futures launch on Robinhoodimagesnewsbitcoin-xrp-sol-futures-launch-on-robinhood3feef3599f1c.jpg Robinhood continues to expand its … By Cointelegraph 2025-06-27
Bitcoin, XRP, SOL futures launch on Robinhood !Bitcoin, XRP, SOL futures launch on Robinhoodimagesnewsbitcoin-xrp-sol-futures-launch-on-robinhood3feef3599f1c.jpg Robinhood continues to expand its … By Cointelegraph 2025-06-27
Why 'Eve Frontier' Is Opening Up to Everyone With Free Trial Experience It is becoming clearer to gamers that blockchain is the technology that allows us to unlock our vision for the game that they want. By Decrypt 2025-06-27
Trump's World Liberty Financial signs partnership deal with London hedge fund !Trumps World Liberty Financial signs partnership deal with London hedge … By Cointelegraph 2025-06-27
Trump's World Liberty Financial signs partnership deal with London hedge fund !Trumps World Liberty Financial signs partnership deal with London hedge … By Cointelegraph 2025-06-27
Trump Punts on Crypto Divestment, Says If US Didn't Have Bitcoin 'China Would' President Trump deflected when asked whether he would consider divesting from personal crypto interests to help get legislation passed. By Decrypt 2025-06-27
Robinhood’s Crypto Keynote Could Be a Chance to Buy the Dip: Compass Point The analyst is expecting a flurry of crypto-related announcements, but nothing to do with stablecoins. By Decrypt 2025-06-27
Will Circle and Tether Soon Face Thousands of Stablecoin Competitors? Unlikely, Says Moody’s Hurdles in banking and retail may make brand-name stablecoins an idea better in theory than in practice, the credit rating agency contends. By Decrypt 2025-06-27
Crypto Fueling Weapons Programs for Sanctioned States: FATF North Korea and Iran are among the states leveraging digital assets to bypass international sanctions, says the Financial Action Task Force. By Decrypt 2025-06-27
Crypto Game Crashouts: The Biggest Shutdowns So Far in 2025 From Deadrop to Nyan Heroes and plenty in between, many promising crypto games have closed up shop this year. These are the biggest so far. By Decrypt 2025-06-27
Flipping Housecoin? Parody Solana Meme Coin Overtakes Token It Was Created to Laugh At Meme coins highlight the absurdity of crypto investing. No more than Chillhouse flipping Housecoin and aiming for Chillguy next. By Decrypt 2025-06-27
Legal strategy matters more than ever for your crypto startup in the UAE !Legal strategy matters more than ever for your crypto startup in the UAEimagesnewslegal-strategy-matters-more-than-ever-for-your-cry2db4999923cb.jpg … By Cointelegraph 2025-06-27
Legal strategy matters more than ever for your crypto startup in the UAE !Legal strategy matters more than ever for your crypto startup in the UAEimagesnewslegal-strategy-matters-more-than-ever-for-your-cry2db4999923cb.jpg … By Cointelegraph 2025-06-27
95 rigs, 1 KamAZ truck: How Russian miners built a mobile crypto farm and got busted !95 rigs, 1 KamAZ truck How Russian miners built a mobile crypto farm and got … By Cointelegraph 2025-06-27
95 rigs, 1 KamAZ truck: How Russian miners built a mobile crypto farm and got busted !95 rigs, 1 KamAZ truck How Russian miners built a mobile crypto farm and got … By Cointelegraph 2025-06-27
Ethereum chart signals ‘altseason’ as analysts predict $10K ETH price top !Ethereum chart signals altseason as analysts predict 10K ETH price topimagesnewsethereum-chart-signals-altseason-as-analysts-predibcb6b062087a.jpg … By Cointelegraph 2025-06-27
Ethereum chart signals ‘altseason’ as analysts predict $10K ETH price top !Ethereum chart signals altseason as analysts predict 10K ETH price topimagesnewsethereum-chart-signals-altseason-as-analysts-predibcb6b062087a.jpg … By Cointelegraph 2025-06-27
Why Are So Many Firms Suing Strategy Over Its Bitcoin Holdings? Bitcoin juggernaut Strategy is facing at least five copycat lawsuitsbut law professors told Decrypt that the number of suits isnt unusual. By Decrypt 2025-06-27
Crypto payments abroad may be legal despite domestic bans in several countries !Crypto payments abroad may be legal despite domestic bans in several … By Cointelegraph 2025-06-27
Crypto payments abroad may be legal despite domestic bans in several countries !Crypto payments abroad may be legal despite domestic bans in several … By Cointelegraph 2025-06-27
Bitcoin loans are back, rewriting the book Celsius burned !Bitcoin loans are back, rewriting the book Celsius burnedimagesnewsbitcoin-loans-are-back-rewriting-the-book-celsius-d6fb91378366.jpg Bitcoin … By Cointelegraph 2025-06-27
Bitcoin loans are back, rewriting the book Celsius burned !Bitcoin loans are back, rewriting the book Celsius burnedimagesnewsbitcoin-loans-are-back-rewriting-the-book-celsius-d6fb91378366.jpg Bitcoin … By Cointelegraph 2025-06-27
Across Protocol DAO under fire over $23M fund misuse claims !Across Protocol DAO under fire over 23M fund misuse claimsimagesnewsacross-protocol-dao-under-fire-over-23m-fund-misus83ee111f3316.jpg Across … By Cointelegraph 2025-06-27
Across Protocol DAO under fire over $23M fund misuse claims !Across Protocol DAO under fire over 23M fund misuse claimsimagesnewsacross-protocol-dao-under-fire-over-23m-fund-misus83ee111f3316.jpg Across … By Cointelegraph 2025-06-27
Russian Mother and Self-Styled 'Crypto Expert' Jailed Over $23M Bitcoin Scam A Moscow court sentenced Bitmama to seven years in jail over a crypto scheme saw millions moved daily through informal deals. By Decrypt 2025-06-27
Small crypto trading prodigy nets $1.5M using unorthodox strategy !Small crypto trading prodigy nets 1.5M using unorthodox strategyimagesnewssmall-crypto-trading-prodigy-nets-1-5m-using-unort501b0bb00f86.jpg A … By Cointelegraph 2025-06-27
Small crypto trading prodigy nets $1.5M using unorthodox strategy !Small crypto trading prodigy nets 1.5M using unorthodox strategyimagesnewssmall-crypto-trading-prodigy-nets-1-5m-using-unort501b0bb00f86.jpg A … By Cointelegraph 2025-06-27
Bitcoin Treasury Corporation to relist on Toronto exchange, buys 292 BTC !Bitcoin Treasury Corporation to relist on Toronto exchange, buys 292 BTCimagesnewsbitcoin-treasury-corporation-to-relist-on-toronto-42545e5cdb0c.jpg … By Cointelegraph 2025-06-27
Bitcoin Treasury Corporation to relist on Toronto exchange, buys 292 BTC !Bitcoin Treasury Corporation to relist on Toronto exchange, buys 292 BTCimagesnewsbitcoin-treasury-corporation-to-relist-on-toronto-42545e5cdb0c.jpg … By Cointelegraph 2025-06-27
Three signs that XRP price will soon break out after 4-month consolidation !Three signs that XRP price will soon break out after 4-month … By Cointelegraph 2025-06-27
Three signs that XRP price will soon break out after 4-month consolidation !Three signs that XRP price will soon break out after 4-month … By Cointelegraph 2025-06-27
Bitcoin long-term holders stack 800K BTC per month in record hodl run !Bitcoin long-term holders stack 800K BTC per month in record hodl runimagesnewsbitcoin-long-term-holders-stack-800k-btc-per-month3ad3638e29ce.jpg … By Cointelegraph 2025-06-27
Bitcoin long-term holders stack 800K BTC per month in record hodl run !Bitcoin long-term holders stack 800K BTC per month in record hodl runimagesnewsbitcoin-long-term-holders-stack-800k-btc-per-month3ad3638e29ce.jpg … By Cointelegraph 2025-06-27
Bit Digital plunges 15% after $150M public offering, Ethereum pivot !Bit Digital plunges 15 after 150M public offering, Ethereum pivotimagesnewsbit-digital-plunges-15-after-150m-public-offering-cfbde86eedd9.jpg Bit … By Cointelegraph 2025-06-27
Bit Digital plunges 15% after $150M public offering, Ethereum pivot !Bit Digital plunges 15 after 150M public offering, Ethereum pivotimagesnewsbit-digital-plunges-15-after-150m-public-offering-cfbde86eedd9.jpg Bit … By Cointelegraph 2025-06-27
Genius Group eyes massive Bitcoin buys from billion-dollar lawsuits !Genius Group eyes massive Bitcoin buys from billion-dollar lawsuitsimagesnewsgenius-group-eyes-massive-bitcoin-buys-from-billio4dbeb2db61fc.jpg If … By Cointelegraph 2025-06-27
Genius Group eyes massive Bitcoin buys from billion-dollar lawsuits !Genius Group eyes massive Bitcoin buys from billion-dollar lawsuitsimagesnewsgenius-group-eyes-massive-bitcoin-buys-from-billio4dbeb2db61fc.jpg If … By Cointelegraph 2025-06-27
Bitcoin ETFs Notch 13 Consecutive Days of Inflow—Why It Matters Most Bitcoin ETF inflows are driven by long-only fundamental investors, not short-term traders, analyst Peter Chung told Decrypt. By Decrypt 2025-06-27
MrBeast Pulls AI Thumbnail Tool Following Backlash The YouTube star has made key changes to an AI tool he recently launched, following copyright concerns from content creators. By Decrypt 2025-06-27
UK’s The Smarter Web Company raises $56M days after big Bitcoin buy !UKs The Smarter Web Company raises 56M days after big Bitcoin buyimagesnewsuks-the-smarter-web-company-raises-56m-days-after-6a57cde425df.jpg … By Cointelegraph 2025-06-27
UK’s The Smarter Web Company raises $56M days after big Bitcoin buy !UKs The Smarter Web Company raises 56M days after big Bitcoin buyimagesnewsuks-the-smarter-web-company-raises-56m-days-after-6a57cde425df.jpg … By Cointelegraph 2025-06-27
Ethereum set for rally as it holds above crucial $2.4K price: Analyst !Ethereum set for rally as it holds above crucial 2.4K price Analystimagesnewsethereum-set-for-rally-as-it-holds-above-crucial-23d5153a488af.jpg … By Cointelegraph 2025-06-27
Ethereum set for rally as it holds above crucial $2.4K price: Analyst !Ethereum set for rally as it holds above crucial 2.4K price Analystimagesnewsethereum-set-for-rally-as-it-holds-above-crucial-23d5153a488af.jpg … By Cointelegraph 2025-06-27
Crypto seed phrase, front-end hacks drive record losses in 2025: TRM Labs !Crypto seed phrase, front-end hacks drive record losses in 2025 TRM Labsimagesnewscrypto-seed-phrase-front-end-hacks-drive-record-lodde3ab01de48.jpg … By Cointelegraph 2025-06-27
Crypto seed phrase, front-end hacks drive record losses in 2025: TRM Labs !Crypto seed phrase, front-end hacks drive record losses in 2025 TRM Labsimagesnewscrypto-seed-phrase-front-end-hacks-drive-record-lodde3ab01de48.jpg … By Cointelegraph 2025-06-27
Coinbase US Perpetuals Are Arriving Next Month as Stock Soars to New Heights Coinbase aims to fill what it describes as a critical gap in the U.S. market, where domestic traders have long relied on offshore platforms. By Decrypt 2025-06-27
US futures hit record high, setting Bitcoin up for new peak: Analysts !US futures hit record high, setting Bitcoin up for new peak Analystsimagesnewsus-futures-hit-record-high-setting-bitcoin-up-for-547f492beacf.jpg US … By Cointelegraph 2025-06-27
Bakkt Files to Sell Up to $1 Billion in Securities For Potential Bitcoin Play The platform is seeking new capital following a policy update earlier this month, allowing it to hold Bitcoin on its balance sheet. By Decrypt 2025-06-27
Coinbase stock ‘going vertical’ as it hits new closing high !Coinbase stock going vertical as it hits new closing highimagesnewscoinbase-stock-going-vertical-as-it-hits-new-closid571b3dbc8b5.jpg One investment … By Cointelegraph 2025-06-27
Bakkt Holdings files $1B shelf offering that could fuel Bitcoin buys !Bakkt Holdings files 1B shelf offering that could fuel Bitcoin buysimagesnewsbakkt-holdings-files-1b-shelf-offering-that-could-6391bea6d524.jpg … By Cointelegraph 2025-06-27
AI crypto app users nearly double this year as funding beats 2024 total !AI crypto app users nearly double this year as funding beats 2024 totalimagesnewsai-crypto-app-users-nearly-double-this-year-as-fun05c293e3c1dd.jpg … By Cointelegraph 2025-06-27
Bitwise Dogecoin, Aptos ETF Filing Updates Suggest Path to Approvals: Analyst Amended Bitwise prospectuses for Dogecoin and Aptos ETFs are a good sign for their eventual approvals, a Bloomberg analyst told Decrypt. By Decrypt 2025-06-27
Metaplanet Boosts Bitcoin Stash Above $1.3 Billion With 1,234 BTC Buy Japans biggest publicly traded Bitcoin treasury company now holds 12,345 BTC, following its latest purchase of 1,234 BTC. By Decrypt 2025-06-26
3 reasons why Bitcoin price could fall below $100,000 !3 reasons why Bitcoin price could fall below 100,000imagesnews3-reasons-why-bitcoin-price-could-fall-below-1000078bb63692ed1.jpg Mounting … By Cointelegraph 2025-06-26
Banking Committee chair sets September goal for market structure bill !Banking Committee chair sets September goal for market structure billimagesnewsbanking-committee-chair-sets-september-goal-for-mab2a153b2fcce.jpg … By Cointelegraph 2025-06-26
Bitwise adds in-kind redemptions to DOGE, APT ETF filings !Bitwise adds in-kind redemptions to DOGE, APT ETF filingsimagesnewsbitwise-adds-in-kind-redemptions-to-doge-apt-etf-fce59e0657ca3.jpg Over 70 crypto … By Cointelegraph 2025-06-26
Avalanche Crypto Game 'Raini: The Lords of Light' Is Shutting Down Blockchain games are closing left and right, with Avalanche-based NFT card game Raini The Lords of Light the latest to join the list. By Decrypt 2025-06-26
Myriad Moves: Will Trump Drop Another F-Bomb? Plus Predictions on Ethereum and Wimbledon Myriad Markets users are placing predictions on President Trumps language, whether Ethereum will rise or fall, and Wimbledons winner. By Decrypt 2025-06-26
Meta hires former OpenAI top talent amid AGI push !Meta hires former OpenAI top talent amid AGI pushimagesnewsmeta-hires-former-openai-top-talent-amid-agi-push857c64486e92.jpg Metas latest AI hire … By Cointelegraph 2025-06-26
UAE company invests $100M in Trump family-backed crypto business !UAE company invests 100M in Trump family-backed crypto businessimagesnewsuae-company-invests-100m-in-trump-family-backed-cre5b71bb2b513.jpg The … By Cointelegraph 2025-06-26
US prosecutor intervenes in FTX-linked case, suggests resolution without trial !US prosecutor intervenes in FTX-linked case, suggests resolution without … By Cointelegraph 2025-06-26
Bitcoin price pattern with 78% accuracy emerges, pointing to new BTC highs !Bitcoin price pattern with 78 accuracy emerges, pointing to new BTC … By Cointelegraph 2025-06-26
Bitcoin Headed for One of the Largest Options Expiries of the Year Bitcoin faces one of its largest options expiries with 15 billion in contracts set to expire Friday as volatility hits multi-year lows. By Decrypt 2025-06-26
Tether, Blackstone Vets Raising $1 Billion for Public Bitcoin, Ethereum and Solana Treasury Former Tether and Blackstone execs plan to build a publicly traded crypto treasury spanning Bitcoin, Ethereum, Solana, and more. By Decrypt 2025-06-26
Core Scientific shares soar as CoreWeave revives buyout talks !Core Scientific shares soar as CoreWeave revives buyout talksimagesnewscore-scientific-shares-soar-as-coreweave-revives-bdb553a1cd700.jpg CoreWeaves … By Cointelegraph 2025-06-26
Kraken debuts 'Krak' peer-to-peer payment system for crypto, fiat transactions !Kraken debuts Krak peer-to-peer payment system for crypto, fiat … By Cointelegraph 2025-06-26
Trump's World Liberty Crypto Project Gets $100 Million Investment From UAE Fund The United Arab Emirates-based Aqua 1 Foundation just bought 100 million worth of tokens from President Trumps World Liberty Financial. By Decrypt 2025-06-26
Crypto firm for Deutsche, Street Street launches private stablecoin contract !Crypto firm for Deutsche, Street Street launches private stablecoin … By Cointelegraph 2025-06-26
US judge denies Ripple, SEC joint request to reduce $125M penalty !US judge denies Ripple, SEC joint request to reduce 125M penaltyimagesnewsus-judge-denies-ripple-sec-joint-request-to-reduce6584adcd65be.jpg Judge … By Cointelegraph 2025-06-26
Moon or Doom: Where Does Ethereum Go Next? Ethereum sits at a crossroads as traders debate whether the second-largest cryptocurrency will finally break through 3,000 or plunge back down to … By Decrypt 2025-06-26
Coinbase Brings Cardano and Litecoin to Base, Joining DOGE and XRP Crypto exchange Coinbase has added new ways for crypto holders to make use of Cardano and Litecoin on its Base network. By Decrypt 2025-06-26
World Chain launches tool to prioritize real humans over bots !World Chain launches tool to prioritize real humans over botsimagesnewsworld-chain-launches-tool-to-prioritize-real-humand7bd05ed3ee4.jpg Created … By Cointelegraph 2025-06-26
Private credit powers $24B tokenization market, Ethereum still dominates — RedStone !Private credit powers 24B tokenization market, Ethereum still dominates … By Cointelegraph 2025-06-26
Coinbase Stock Eyes Record Close as Analysts Project Massive Gains A drumbeat of positive regulatory news under U.S. President Donald Trump has buoyed the stock, one analyst said. By Decrypt 2025-06-26
Bitcoin analysts say this must happen for BTC price to break $112K !Bitcoin analysts say this must happen for BTC price to break 112Kimagesnewsbitcoin-analysts-say-this-must-happen-for-btc-pric9e12a64690b4.jpg Pickup … By Cointelegraph 2025-06-26
Kraken Debuts Krak Crypto and Fiat Payments App Across 110 Countries The crypto exchanges offering will compete with other cash apps, including PayPal and Jack Dorseys Cash App. By Decrypt 2025-06-26
Ripple Stuck With $125 Million Penalty as Judge Denies XRP Settlement With SEC While the SEC has become more crypto friendly, a federal judge in Manhattan found that the law hasnt changed. By Decrypt 2025-06-26
Can Bitcoin ETFs replace bonds in institutional portfolios? !Can Bitcoin ETFs replace bonds in institutional portfolios?imagesnewscan-bitcoin-etfs-replace-bonds-in-institutional-pob56b5d579991.jpg As Bitcoin … By Cointelegraph 2025-06-26
The multichain future might kill DeFi before it saves it !The multichain future might kill DeFi before it saves itimagesnewsthe-multichain-future-might-kill-defi-before-it-sa46e32db3e198.jpg The explosion … By Cointelegraph 2025-06-26
Hacker Drains $9.6 Million From DeFi Stablecoin Protocol Resupply Users should avoid reUSD vaults and withdraw funds if possible, one security expert told Decrypt. By Decrypt 2025-06-26
Bitcoin price starts 'normal and healthy' support test as $108K halts bulls !Bitcoin price starts normal and healthy support test as 108K halts bullsimagesnewsbitcoin-price-starts-normal-and-healthy-support-te2627f37f1854.jpg … By Cointelegraph 2025-06-26
Pi2Day could change Pi network forever: Here’s what to know before June 28 !Pi2Day could change Pi network forever Heres what to know before June 28imagesnewspi2day-could-change-pi-network-forever-heres-what-42f5aa0f6928.jpg … By Cointelegraph 2025-06-26
FBI busts alleged BreachForums admin ‘IntelBroker’ with $250 Bitcoin sting !FBI busts alleged BreachForums admin IntelBroker with 250 Bitcoin stingimagesnewsfbi-busts-alleged-breachforums-admin-intelbroker-wcbb545e5ec1c.jpg … By Cointelegraph 2025-06-26
Bitcoin and Ethereum Flat as Iran Claims Victory Over US Bitcoin and Ethereum have inched forward, as 77 of Myriad Market users signal theyre certain Irans supreme leader will remain in power. By Decrypt 2025-06-26
Brussels’ softer tone on foreign stablecoins sparks industry optimism !Brussels softer tone on foreign stablecoins sparks industry optimismimagesnewsbrussels-softer-tone-on-foreign-stablecoins-sparks40d142c9b8c7.jpg The … By Cointelegraph 2025-06-26
Indian politician calls for Bitcoin reserve pilot as US embraces BTC !Indian politician calls for Bitcoin reserve pilot as US embraces BTCimagesnewsindian-politician-calls-for-bitcoin-reserve-pilot-66d360693391.jpg … By Cointelegraph 2025-06-26
New Billions app offers secure ID checks without invasive biometrics !New Billions app offers secure ID checks without invasive biometricsimagesnewsnew-billions-app-offers-secure-id-checks-without-i511fee364197.jpg … By Cointelegraph 2025-06-26
Wall Street buys over $1B in Bitcoin amid dollar's ‘do or die’ moment !Wall Street buys over 1B in Bitcoin amid dollars do or die momentimagesnewswall-street-buys-over-1b-in-bitcoin-amid-dollar-s-4216accfdb12.jpg Trumps … By Cointelegraph 2025-06-26
Telegram Users Can Now Earn 'Institutional-Grade' Financial Rewards on Staked TON A new collaboration between P2P.org and Ton Whales will allow Telegram users to earn rewards, starting with less than 30 worth of TON. By Decrypt 2025-06-26
How to read a stablecoin attestation report and why it matters !How to read a stablecoin attestation report and why it mattersimagesnewshow-to-read-a-stablecoin-attestation-report-and-whd332ce5498d1.jpg Knowing … By Cointelegraph 2025-06-26
DeFAI layer Edwin blends wallets and AI chatbot with terminal launch !DeFAI layer Edwin blends wallets and AI chatbot with terminal launchimagesnewsdefai-layer-edwin-blends-wallets-and-ai-chatbot-wib3537a0226de.jpg The … By Cointelegraph 2025-06-26
Stablecoin protocol Resupply loses $9.6M to price manipulation exploit !Stablecoin protocol Resupply loses 9.6M to price manipulation exploitimagesnewsstablecoin-protocol-resupply-loses-9-6m-to-price-m3caa18f50edc.jpg A … By Cointelegraph 2025-06-26
Meta and OpenAI Use of Copyrighted Books for Training AI Was Fair Use: Federal Judge These plaintiffs made the wrong arguments, Judge Chhabria wrote, as he ruled Metas AI training on their copyrighted books was fair use. By Decrypt 2025-06-26
Bitcoin ‘Satoshi-era’ miners sold just 150 BTC in 2025 amid all-time highs !Bitcoin Satoshi-era miners sold just 150 BTC in 2025 amid all-time highsimagesnewsbitcoin-satoshi-era-miners-sold-just-150-btc-in-201e92f9aa2d2f.jpg … By Cointelegraph 2025-06-26
Galaxy Digital raises $175M in first fund to expand crypto investments !Galaxy Digital raises 175M in first fund to expand crypto investmentsimagesnewsgalaxy-digital-raises-175m-in-first-fund-to-expandf401cc258f64.jpg … By Cointelegraph 2025-06-26
Hong Kong reveals new stablecoin rules and tokenized bond plans !Hong Kong reveals new stablecoin rules and tokenized bond plansimagesnewshong-kong-reveals-new-stablecoin-rules-and-tokeniz82277cc0e9a7.jpg Hong … By Cointelegraph 2025-06-26
Pi Network token spikes 38% on AI plans, Google partnership rumors !Pi Network token spikes 38 on AI plans, Google partnership rumorsimagesnewspi-network-token-spikes-38-on-ai-plans-google-part8a249e6929ce.jpg Pi … By Cointelegraph 2025-06-26
Japan’s Metaplanet buys 1,234 BTC, now holds more than Tesla !Japans Metaplanet buys 1,234 BTC, now holds more than Teslaimagesnewsjapans-metaplanet-buys-1234-btc-now-holds-more-thafd0f626747ba.jpg Metaplanet … By Cointelegraph 2025-06-26
Trump-backed World Liberty to release stablecoin audit, make WLFI transferable !Trump-backed World Liberty to release stablecoin audit, make WLFI … By Cointelegraph 2025-06-26
Zero-knowledge proofs, explained !Zero-knowledge proofs, explainedimagesnewszero-knowledge-proofs-explained2913c49139ff.jpg Zero-knowledge proofs are a game-changing innovation with … By Cointelegraph 2025-06-26
Kraken Becomes Latest to Win a License Under Europe's New Rules Approval from Irelands central bank gives Kraken the ability to operate across 27 EU states as it races to catch up to rival Coinbase. By Decrypt 2025-06-26
‘Major bummer’ — Users discover Ledger is sunsetting the ‘OG’ Nano S !Major bummer Users discover Ledger is sunsetting the OG Nano Simagesnewsmajor-bummer-users-discover-ledger-is-sunsetting-t678254fd6a5b.jpg Some … By Cointelegraph 2025-06-26
ASIC Appoints Panel to Probe ASX Following Failed Blockchain Project The inquiry will assess the ASXs governance, capability, and risk management frameworks across its group operations. By Decrypt 2025-06-26
Citibank accused of ignoring signs of $20M crypto romance scam !Citibank accused of ignoring signs of 20M crypto romance scamimagesnewscitibank-accused-of-ignoring-signs-of-20m-crypto-rf4bc74e48693.jpg The victim … By Cointelegraph 2025-06-26
Bit Digital falls 4% as it ditches Bitcoin mining for Ethereum !Bit Digital falls 4 as it ditches Bitcoin mining for Ethereumimagesnewsbit-digital-falls-4-as-it-ditches-bitcoin-mining-fe6027360e5d9.jpg The crypto … By Cointelegraph 2025-06-26
ASX-Listed Biotech Firm Latest to Adopt a Bitcoin Strategy to Stay Afloat Opyl is betting on the so-called Bitcoin treasury strategy to navigate its financial chop and follow recent examples set by others. By Decrypt 2025-06-26
Coinme pays $300K fine for violating California crypto ATM laws !Coinme pays 300K fine for violating California crypto ATM lawsimagesnewscoinme-pays-300k-fine-for-violating-california-cry7c05b3e13778.jpg The case … By Cointelegraph 2025-06-26
GameStop fails to woo traders with $450M raise, possibly for Bitcoin !GameStop fails to woo traders with 450M raise, possibly for Bitcoinimagesnewsgamestop-fails-to-woo-traders-with-450m-raise-poss2034859a58aa.jpg … By Cointelegraph 2025-06-26
SoFi digital bank brings back crypto services after 2-year hiatus !SoFi digital bank brings back crypto services after 2-year hiatusimagesnewssofi-digital-bank-brings-back-crypto-services-afteda41341cfea3.jpg SoFi … By Cointelegraph 2025-06-26
‘Fiat is fading’ — USD lowest in 3 years as Bitcoin reclaims $107K !Fiat is fading USD lowest in 3 years as Bitcoin reclaims 107Kimagesnewsfiat-is-fading-usd-lowest-in-3-years-as-bitcoin-re7712f9f7c675.jpg … By Cointelegraph 2025-06-26
Crypto ATM sting uncovers elderly widow who lost $281K in a scam !Crypto ATM sting uncovers elderly widow who lost 281K in a scamimagesnewscrypto-atm-sting-uncovers-elderly-widow-who-lost-263e958fb6036.jpg One of … By Cointelegraph 2025-06-26
US Housing Chief Orders Fannie Mae, Freddie Mac to Prepare for Crypto Assessment in Mortgages Under a directive from the FHFA, Fannie Mae and Freddie Mac were ordered to prepare for crypto mortgage payments. By Decrypt 2025-06-26
Solana, Pudgy Penguins ETF Filings Added to SEC's Crypto To-Do List A proposal for a Solana ETF and a new fund tied to Pudgy Penguins tokens have joined a growing list of products offering crypto exposure. By Decrypt 2025-06-25
Invesco Galaxy files for Solana ETF, 9 issuers now in the race !Invesco Galaxy files for Solana ETF, 9 issuers now in the raceimagesnewsinvesco-galaxy-files-for-solana-etf-9-issuers-now-838bac97a190.jpg Invesco … By Cointelegraph 2025-06-25
ETH ETF flows impress, but Ether futures data suggest traders exercise caution !ETH ETF flows impress, but Ether futures data suggest traders exercise … By Cointelegraph 2025-06-25
Google's AlphaGenome AI Makes DNA Readable—And It's on GitHub AlphaGenome, accessible via API, cracks the junk DNA code, outperforms top rivals in key tests, and puts advanced genomics tools within reach of labs … By Decrypt 2025-06-25
Prediction market Kalshi raises $185M at $2B valuation — Report !Prediction market Kalshi raises 185M at 2B valuation Reportimagesnewsprediction-market-kalshi-raises-185m-at-2b-valuati013429748b73.jpg Kalshi … By Cointelegraph 2025-06-25
Prediction Market Kalshi Notches $2 Billion Valuation With $185 Million Raise Kalshi achieved unicorn status following its latest Series C funding round, amid the prediction markets platforms growing crypto embrace. By Decrypt 2025-06-25
Crypto exchange Kraken secures MiCA license in Ireland !Crypto exchange Kraken secures MiCA license in Irelandimagesnewscrypto-exchange-kraken-secures-mica-license-in-ire00532510f2c0.jpg Several exchanges … By Cointelegraph 2025-06-25
Will GameStop Buy More Bitcoin? GME Boosts Latest Fundraise to $2.7 Billion GameStop raised another 450 million that it can use to buy Bitcoin, boosting its latest raise to 2.7 billion. Will it grab more BTC? By Decrypt 2025-06-25
Unhedged spot Bitcoin ETF flows show BTC is now a macro asset !Unhedged spot Bitcoin ETF flows show BTC is now a macro assetimagesnewsunhedged-spot-bitcoin-etf-flows-show-btc-is-now-a-2ef257d4fc7a.jpg Data shows … By Cointelegraph 2025-06-25
US Senator sets 2026 goal for two crypto bills !US Senator sets 2026 goal for two crypto billsimagesnewsus-senator-sets-2026-goal-for-two-crypto-billsa59339a58c1c.jpg Cynthia Lummis said she … By Cointelegraph 2025-06-25
Crypto VCs Crown New Unicorn as Confidentiality Startup Zama Raises $57M at $1 Billion Valuation Zama raised 57 million and launched a public testnet aimed at bringing privacy and encrypted smart contracts to public blockchains. By Decrypt 2025-06-25
Why Did Solana and Ethereum Treasury Stocks Plunge on Routine SEC Filings? Some investors are piling into crypto treasury firms, while PIPE investors are taking gains. By Decrypt 2025-06-25
Fannie Mae, Freddie Mac to recognize crypto assets in mortgage risk assessments !Fannie Mae, Freddie Mac to recognize crypto assets in mortgage risk … By Cointelegraph 2025-06-25
Bitcoin bulls gain edge, target $110K ahead of $20B monthly options expiry !Bitcoin bulls gain edge, target 110K ahead of 20B monthly options expiryimagesnewsbitcoin-bulls-gain-edge-target-110k-ahead-of-20b-m6f9e852fff3e.jpg … By Cointelegraph 2025-06-25
USD Stablecoins Could Flood Europe as US Legislation Forces EU's Hand: Moody's The EU plans to announce the elimination of a barrier that prevented dollar-backed stablecoins from flooding the bloc, per a new report. By Decrypt 2025-06-25
Barclays to ban crypto transactions on credit cards from Friday !Barclays to ban crypto transactions on credit cards from Fridayimagesnewsbarclays-to-ban-crypto-transactions-on-credit-card2e4b9602db4c.jpg The move … By Cointelegraph 2025-06-25
Price predictions 6/25: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, SUI !Price predictions 625 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, SUIimagesnewsprice-predictions-6-25-btc-eth-xrp-bnb-sol-doge-ade24c59bbb014.jpg … By Cointelegraph 2025-06-25
Bitcoin Cash Breaks Out, Cardano Breaks Down as Crypto Traders Hold Breath on Fed: Analysis Bitcoin Cash breaks key resistance amid renewed demand while Cardano tests critical support levels in sideways market conditions. By Decrypt 2025-06-25
UK Bitcoin Reserve Company Buys More BTC, Stock Continues to Rise UK web companys Bitcoin strategy delivers 6,400 stock gains, sparking copycat wave as CEO claims most successful IPO in UK history. By Decrypt 2025-06-25
Change in US crypto laws may affect charges in Do Kwon’s criminal case !Change in US crypto laws may affect charges in Do Kwons criminal caseimagesnewschange-in-us-crypto-laws-may-affect-charges-in-do-f5a7b5e0face.jpg In … By Cointelegraph 2025-06-25
Bitcoin’s next stop could be $120K: BTC analysts explain why !Bitcoins next stop could be 120K BTC analysts explain whyimagesnewsbitcoins-next-stop-could-be-120k-btc-analysts-expldd6bf2fefec0.jpg A sharp drop … By Cointelegraph 2025-06-25
SoFi Is Getting Back Into Crypto, Starting With Bitcoin and Ethereum After dropping crypto in 2023, SoFi is getting back in the game with Bitcoin and Ethereum trading, stablecoins, lending, and beyond. By Decrypt 2025-06-25
Coinbase Stock ‘Misunderstood’, Could Skyrocket on Stablecoin Boom: Bernstein The analysts set a price target of 510, writing that the share price could also benefit from the companys varied initiatives and dominant market … By Decrypt 2025-06-25
The corporate Bitcoin gold rush is on — but at what cost? !The corporate Bitcoin gold rush is on but at what cost?imagesnewsthe-corporate-bitcoin-gold-rush-is-on-but-at-what-06f6d2c860b8.jpg Cointelegraph … By Cointelegraph 2025-06-25
Coinbase stock approaches all-time high following 42% year-to-date gain !Coinbase stock approaches all-time high following 42 year-to-date gainimagesnewscoinbase-stock-approaches-all-time-high-following-d571b3dbc8b5.jpg … By Cointelegraph 2025-06-25
US home mortgage regulator considers Bitcoin amid housing crisis !US home mortgage regulator considers Bitcoin amid housing crisisimagesnewsus-home-mortgage-regulator-considers-bitcoin-amid-594ad55cc1d2.jpg The … By Cointelegraph 2025-06-25
Bitcoin’s ‘bull pennant’ targets $165K as BTC exchange flows hit 10-year lows !Bitcoins bull pennant targets 165K as BTC exchange flows hit 10-year … By Cointelegraph 2025-06-25
Bitcoin vs. sovereign bonds: Why are some investors making the shift? !Bitcoin vs. sovereign bonds Why are some investors making the shift?imagesnewsbitcoin-vs-sovereign-bonds-why-are-some-investors-09f3fd827075.jpg … By Cointelegraph 2025-06-25
Ethereum ‘death cross’ flashes for the first time since 2022 ETH price crash !Ethereum death cross flashes for the first time since 2022 ETH price … By Cointelegraph 2025-06-25
Spoils of $1.5 Billion Bybit Hack Traced to Greek Crypto Exchange: Report An unidentified individual received a large sum of Ethereum into a wallet on a Greek exchange, prompting local authorities to investigate. By Decrypt 2025-06-25
Bitcoin-stocks correlation signals USD fragility and not risk-on fervor !Bitcoin-stocks correlation signals USD fragility and not risk-on fervorimagesnewsbitcoin-stocks-correlation-signals-usd-fragility-a44ed4e0758c7.jpg … By Cointelegraph 2025-06-25
The $1,150 trademark that could change crypto: What’s hiding in JPMorgan’s JPMD filing? !The 1,150 trademark that could change crypto Whats hiding in JPMorgans JPMD … By Cointelegraph 2025-06-25
Kraken Embed is a 'One-Stop Shop' for TradFi Crypto Integrations Decrypt is joined by Brett McLain, Head of Payments and Blockchain Business Unit at Kraken, to discuss why liquidity matters more to traders than … By Decrypt 2025-06-25
Bitcoin bulls 'in control' as BTC price spikes to $108K !Bitcoin bulls in control as BTC price spikes to 108Kimagesnewsbitcoin-bulls-in-control-as-btc-price-spikes-to-106e8e9c49f0b8.jpg Bitcoin delivers a … By Cointelegraph 2025-06-25
German regulator closes case against Ethena GmbH over USDe issuance !German regulator closes case against Ethena GmbH over USDe issuanceimagesnewsgerman-regulator-closes-case-against-ethena-gmbh-o1e30b33bc067.jpg … By Cointelegraph 2025-06-25
Can AI Crack the Cat Code? Baidu Thinks So A new patent proposes translating cat meows and body language into plain speech, but scientists say the technology may still be chasing its tail. By Decrypt 2025-06-25
Crypto in a time of crisis: Can decentralized fintech hold the line? !Crypto in a time of crisis Can decentralized fintech hold the line?imagesnewscrypto-in-a-time-of-crisis-can-decentralized-finte83b6985c2ffd.jpg As … By Cointelegraph 2025-06-25
Animoca-backed Moca Chain launches for decentralized digital identity !Animoca-backed Moca Chain launches for decentralized digital identityimagesnewsanimoca-backed-moca-chain-launches-for-decentralizd4769a949142.jpg … By Cointelegraph 2025-06-25
Russian ruble stablecoin A7A5 tied to Garantex successor: FT !Russian ruble stablecoin A7A5 tied to Garantex successor FTimagesnewsrussian-ruble-stablecoin-a7a5-tied-to-garantex-suc0c017e79b652.jpg With a 151 … By Cointelegraph 2025-06-25
South Korean banks plan won-pegged stablecoin launch by 2026 !South Korean banks plan won-pegged stablecoin launch by 2026imagesnewssouth-korean-banks-plan-won-pegged-stablecoin-launacca9a460975.jpg Eight major … By Cointelegraph 2025-06-25
Polymarket Nails NYC Democratic Mayoral Primary Upset, Nears $1B Unicorn Valuation Blockchain-based prediction markets correctly forecast Zohran Mamdanis Democratic NYC mayoral primary victory. By Decrypt 2025-06-25
Bitcoin hashrate down ~15% since June 15, steepest drop in 3 years !Bitcoin hashrate down 15 since June 15, steepest drop in 3 yearsimagesnewsbitcoin-hashrate-down-15-since-june-15-steepest-dr9acdf7f98a47.jpg In what … By Cointelegraph 2025-06-25
BIS says stablecoins fail as money, calls for strict limits on their role !BIS says stablecoins fail as money, calls for strict limits on their … By Cointelegraph 2025-06-25
Bitcoin price analysis now sees up to $111K liquidity grab next !Bitcoin price analysis now sees up to 111K liquidity grab nextimagesnewsbitcoin-price-analysis-now-sees-up-to-111k-liquidi53a489b1d906.jpg Bitcoin … By Cointelegraph 2025-06-25
XRP price ‘breakout is coming’ between July and September: Analyst !XRP price breakout is coming between July and September Analystimagesnewsxrp-price-breakout-is-coming-between-july-and-septa7c00f6502db.jpg … By Cointelegraph 2025-06-25
Fuzzland says ex-employee was behind $2M Bedrock UniBTC exploit !Fuzzland says ex-employee was behind 2M Bedrock UniBTC exploitimagesnewsfuzzland-says-ex-employee-was-behind-2m-bedrock-un754b93aa5866.jpg Fuzzland … By Cointelegraph 2025-06-25
Anthropic Scores Partial Victory in Copyright Case Over AI Training Data The AI firm downloaded over seven million pirated books to assemble its research library, internal emails revealed. By Decrypt 2025-06-25
Bitcoin ETFs log biggest June inflows at $588M, extend 11-day streak !Bitcoin ETFs log biggest June inflows at 588M, extend 11-day streakimagesnewsbitcoin-etfs-log-biggest-june-inflows-at-588m-exte64ef5fe9e66f.jpg US … By Cointelegraph 2025-06-25
Genesis lawsuit alleges DCG ‘alter ego’ scheme, ignored warnings !Genesis lawsuit alleges DCG alter ego scheme, ignored warningsimagesnewsgenesis-lawsuit-alleges-dcg-alter-ego-scheme-ignor99480cd21169.jpg A newly … By Cointelegraph 2025-06-25
Ledger Deal with NBA Team is Latest Sign of Crypto Sports Partnership Revival The San Antonio Spurs, a basketball team, debuted their Ledger-branded jerseys at the NBA draft on Tuesday. By Decrypt 2025-06-25
Everyone laughed at these 10 gadgets. Now, they’re in every home !Everyone laughed at these 10 gadgets. Now, theyre in every homeimagesnewseveryone-laughed-at-these-10-gadgets-now-theyre-in4a987c28d383.jpg From … By Cointelegraph 2025-06-25
Arizona House Clears Bitcoin Reserve Bill Funded by Seized Crypto The bill directs the first 300,000 from seized crypto to the Attorney General, with the remaining funds split between the state and reserve. By Decrypt 2025-06-25
South Korea’s central bank wants gradual stablecoin rollout !South Koreas central bank wants gradual stablecoin rolloutimagesnewssouth-koreas-central-bank-wants-gradual-stablecoin01497f8b9584.jpg Bank of Korea … By Cointelegraph 2025-06-25
SharpLink Gaming stock rallies 7% after $30M Ethereum buy !SharpLink Gaming stock rallies 7 after 30M Ethereum buyimagesnewssharplink-gaming-stock-rallies-7-after-30m-ethereud0d723115bb1.jpg SharpLink Gaming … By Cointelegraph 2025-06-25
Michael Saylor’s Strategy has 91% chance of joining S&P 500 in Q2: Analyst !Michael Saylors Strategy has 91 chance of joining SP 500 in Q2 Analystimagesnewsmichael-saylors-strategy-has-91-chance-of-joining-07bb73d27117.jpg … By Cointelegraph 2025-06-25
Stablecoin Issuance Should Begin With Banks, Says BOK Official The Bank of Korea deputy governor said the move would create a safety net and reduce risks as the nation advances its crypto policies. By Decrypt 2025-06-25
How the ‘SparkKitty’ Trojan Is Stealing Crypto Wallet Data From Phones A trojan known as SparkKitty embeds itself in TikTok mods and crypto apps, targeting users in China and Southeast Asia. By Decrypt 2025-06-25
Anthony Pompliano’s crypto venture buys $386M in Bitcoin !Anthony Pomplianos crypto venture buys 386M in Bitcoinimagesnewsanthony-pomplianos-crypto-venture-buys-386m-in-bitc4ddc7926672.jpg Anthony … By Cointelegraph 2025-06-25
Norway deep-sea mining firm plans $1.2B Bitcoin buy !Norway deep-sea mining firm plans 1.2B Bitcoin buyimagesnewsnorway-deep-sea-mining-firm-plans-1-2b-bitcoin-buyd19590fc0d0b.jpg Green Minerals says … By Cointelegraph 2025-06-25
Athena Bitcoin Clears Way For Early Investors to Sell Shares Athena has filed to register shares previously issued through debt conversions, enabling early investors to exit without raising new capital. By Decrypt 2025-06-25
Polymarket set for $200M raise at $1B valuation: Reports !Polymarket set for 200M raise at 1B valuation Reportsimagesnewspolymarket-set-for-200m-raise-at-1b-valuation-repo5c543ae61c1d.jpg Betting platform … By Cointelegraph 2025-06-25
Senate Banking Committee Sets Out Plan For Crypto Market Rules The principles aim to define digital asset oversight as debates over Trump-linked crypto profits and federal legislation intensify. By Decrypt 2025-06-25
US crypto stocks surge amid fragile Iran-Israel ceasefire !US crypto stocks surge amid fragile Iran-Israel ceasefireimagesnewsus-crypto-stocks-surge-amid-fragile-iran-israel-ceb8dfb794fce5.jpg US crypto … By Cointelegraph 2025-06-25
Bernie Sanders Blasts AI Firms Over Jobs Displacement: ‘They Couldn’t Care Less’ Vermont Senator Bernie Sanders warned that AI will uproot workers unless reforms shift power from CEOs to the American people. By Decrypt 2025-06-25
Coinbase claims ‘key role’ in Secret Service’s biggest-ever crypto seizure !Coinbase claims key role in Secret Services biggest-ever crypto seizureimagesnewscoinbase-claims-key-role-in-secret-services-bigges1a0b3cab4d46.jpg … By Cointelegraph 2025-06-25
NYSE Files for Rule Change to List Trump Bitcoin Ethereum ETF NYSE applied for a rule change enabling the listing of a BTC-ETH ETF proposed by President Donald Trumps media and tech company. By Decrypt 2025-06-25
Norwegian Mineral Mining Firm Eyes $1.2 Billion Raise for Bitcoin Treasury Green Minerals has adopted the Bitcoin treasury strategy as a step towards broader blockchain implementation. By Decrypt 2025-06-25
Ozempic's Newest Miracle: Dramatically Cutting Dementia Risk New research tracking 1.7 million diabetics shows the weight-loss drug slashes dementia risk by up to 70. By Decrypt 2025-06-24
Bitcoin in the Buckeye State: Ohio Eyes Its Own Crypto Reserve Ohio Rep. Steve Demetriou, a Bitcoin advocate, said lawmakers should follow the lead of nearly 2 million Ohioans who own digital assets. By Decrypt 2025-06-24
BNB Over Bitcoin? Chinese Company's Stock Skyrockets on $1 Billion Crypto Treasury Plan Could BNB be the next cryptocurrency after Bitcoin to trend big on Wall Street? Two companies have announced treasury plans this week. By Decrypt 2025-06-24
Many senators absent from ‘bipartisan’ crypto market structure hearing !Many senators absent from bipartisan crypto market structure hearingimagesnewsmany-senators-absent-from-bipartisan-crypto-market2b684f03f4a6.jpg … By Cointelegraph 2025-06-24
FalconX joins Crypto.com as partner for Lynq institutional settlement network !FalconX joins Crypto.com as partner for Lynq institutional settlement … By Cointelegraph 2025-06-24
Pompliano Bitcoin Treasury ProCap Buys $395 Million in BTC The firm, which intends to go public via a SPAC deal with Columbus Circle Capital, added 3,724 Bitcoin to its balance sheet this week. By Decrypt 2025-06-24
Til Death Do Us Part: The Weirdest Meme Coin Livestreams We've Seen Just This Week Solana token launchpad Pump.fun is heating up with wild livestreams, including a wedding and one guy saying Pumpfun a million times. By Decrypt 2025-06-24
Ether liquidity sits above $2.5K: Will ETH bulls grab it? !Ether liquidity sits above 2.5K Will ETH bulls grab it?imagesnewsether-liquidity-sits-above-2-5k-will-eth-bulls-grac43d28bf4a01.jpg Ether gains … By Cointelegraph 2025-06-24
Largest Bitcoin Leverage Unwind in Nearly a Year Triggered by Iran-Israel Tensions Notional open interest in BTC perps saw the sharpest decline since the yen-led global market crash in August 2024. By Decrypt 2025-06-24
Bitcoin rebounds to $105K as Coinbase premium hits second 2025 high !Bitcoin rebounds to 105K as Coinbase premium hits second 2025 highimagesnewsbitcoin-rebounds-to-105k-as-coinbase-premium-hits-2cc83ec0c41b.jpg … By Cointelegraph 2025-06-24
FinTech Digital Asset Raises $135M for Its Institutional Blockchain Canton Network DRW Venture Capital and Tradeweb Markets led the funding round, which also included Circle Ventures, Goldman Sachs, and Citadel Securities. By Decrypt 2025-06-24
NYC mayor lays out crypto plans as city residents vote in Democratic primary !NYC mayor lays out crypto plans as city residents vote in Democratic … By Cointelegraph 2025-06-24
ETH trades near $2.5K, but weak demand clouds bullish outlook !ETH trades near 2.5K, but weak demand clouds bullish outlookimagesnewseth-trades-near-2-5k-but-weak-demand-clouds-bullis49d60124a2cb.jpg Ether … By Cointelegraph 2025-06-24
Chainlink, Mastercard partner to allow 3 billion cardholders to buy crypto !Chainlink, Mastercard partner to allow 3 billion cardholders to buy … By Cointelegraph 2025-06-24
Ethereum and XRP Pump on Relief Rally, But These Coins Are Mooning Harder: Analysis Risk-on appetite for crypto returns with a vengeance as geopolitical tensions ease, sending speculative assets soaring to multi-week highs. By Decrypt 2025-06-24
SharpLink Gaming Boosts Ethereum Treasury Stash to $461 Million The largest publicly traded Ethereum treasury company, SharpLink Gaming, added more than 30 million worth of ETH to its stash last week. By Decrypt 2025-06-24
Microsoft-Backed Space and Time Surges as Grayscale Debuts SXT Crypto Fund SXTs daily gains extended as Grayscale announced a fund that allows its clients to invest in the Space and Time blockchains native token. By Decrypt 2025-06-24
'It's a Great Thing': Fed Chair Powell Backs US Crypto Bills Federal Reserve Chair Jerome Powell shared support for crypto legislation before Congress, signaling that the U.S. would benefit from regulatory … By Decrypt 2025-06-24
Ex-US top regulator warns of conflicts of interest as Senate weighs market structure !Ex-US top regulator warns of conflicts of interest as Senate weighs market … By Cointelegraph 2025-06-24
Ledger Introduces Physical ‘Recovery Key’ NFC Backup for Wallets The spare key is designed to make wallet recovery more easy while still keeping your Ledger wallet secure. By Decrypt 2025-06-24
Aptos Labs, Jump Crypto launch Web3 cloud storage layer !Aptos Labs, Jump Crypto launch Web3 cloud storage layerimagesnewsaptos-labs-jump-crypto-launch-web3-cloud-storage-l5368f7a3e879.jpg Shelby launches … By Cointelegraph 2025-06-24
Crypto spoofing for dummies: How traders trick the market !Crypto spoofing for dummies How traders trick the marketimagesnewscrypto-spoofing-for-dummies-how-traders-trick-the-e19f685fc866.jpg Fake orders, … By Cointelegraph 2025-06-24
President Trump Meme Coin Jumps as He Begs Israel Not to Break Ceasefire Deal Iran and Israel have continued to fire missiles at each other despite a ceasefire agreement that President Trump wants to uphold. By Decrypt 2025-06-24
Bitcoin Is Getting Native, Dollar-Backed Stablecoin USDB Flashnet and Brale are gearing up to launch the Bitcoin-native, dollar-backed USDB stablecoin this summer in collaboration with Magic Eden. By Decrypt 2025-06-24
Tokenized US Treasurys increase market risk vectors !Tokenized US Treasurys increase market risk vectorsimagesnewstokenized-us-treasurys-increase-market-risk-vector521eddb20feb.jpg Tokenized US … By Cointelegraph 2025-06-24
VanEck warns: Why Bitcoin treasury companies could face capital erosion !VanEck warns Why Bitcoin treasury companies could face capital erosionimagesnewsvaneck-warns-why-bitcoin-treasury-companies-could-2155e1a6a381.jpg … By Cointelegraph 2025-06-24
USDC Issuer Circle Stumbles on Neutral Rating From Compass Point Circle stock falls 6 on analyst skepticism despite stablecoin growth potential, as USDC market share declines amid rising competition concerns. By Decrypt 2025-06-24
Predictive intelligence is the upgrade blockchain can’t afford to miss !Predictive intelligence is the upgrade blockchain cant afford to missimagesnewspredictive-intelligence-is-the-upgrade-blockchain-5e90e17e7479.jpg … By Cointelegraph 2025-06-24
Mastercard Taps Fiserv Stablecoin for ‘New Era’ of Payments Through the partnership, the companies will explore how business can transition smoothly between fiat currency and FIUSD. By Decrypt 2025-06-24
Nano Labs to issue $500M of convertible notes to fund BNB treasury !Nano Labs to issue 500M of convertible notes to fund BNB treasuryimagesnewsnano-labs-to-issue-500m-of-convertible-notes-to-fu15f4318ae0e7.jpg … By Cointelegraph 2025-06-24
June remains Bitcoin’s danger zone, while S&P 500 eyes summer rally !June remains Bitcoins danger zone, while SP 500 eyes summer rallyimagesnewsjune-remains-bitcoins-danger-zone-while-s-p-500-eyf5073bb49181.jpg If … By Cointelegraph 2025-06-24
How to use GitHub, Discord, and X to find hidden crypto gems early !How to use GitHub, Discord, and X to find hidden crypto gems earlyimagesnewshow-to-use-github-discord-and-x-to-find-hidden-cryaab2f0e7452f.jpg Hype … By Cointelegraph 2025-06-24
Hacked Crypto Exchange WazirX Gets More Time to Restructure After Court Ruling The exchanges crypto operations are reportedly moving to Panama as part of its restructuring, ahead of Singapores June 30 deadline. By Decrypt 2025-06-24
Major Validators Join Testnet to Tackle Ethereum’s Overlooked Bottleneck Network operators controlling at least 14 of Ethereums stake are testing a new data propagation system promising 10x speed improvements. By Decrypt 2025-06-24
Digital Asset raises $135M to scale Canton blockchain network !Digital Asset raises 135M to scale Canton blockchain networkimagesnewsdigital-asset-raises-135m-to-scale-canton-blockcha0ed395e450c7.jpg Digital … By Cointelegraph 2025-06-24
Trump administration mulls ‘debanking’ executive order: WSJ !Trump administration mulls debanking executive order WSJimagesnewstrump-administration-mulls-debanking-executive-ord271b45414cfe.jpg Trump may issue … By Cointelegraph 2025-06-24
Altcoin Sei Leaps 47% Following Wyoming Stablecoin Candidacy Analysts told Decrypt that Seis strong on-chain growth over the preceding months could help support its recent price gains. By Decrypt 2025-06-24
Bitcoin $105K 'trend switch' comes as Fed hints at July rate cut !Bitcoin 105K trend switch comes as Fed hints at July rate cutimagesnewsbitcoin-105k-trend-switch-comes-as-fed-hints-at-ju2d3387d415f6.jpg Bitcoin … By Cointelegraph 2025-06-24
Japan proposes reclassifying crypto, paving way for ETFs and lower taxes !Japan proposes reclassifying crypto, paving way for ETFs and lower taxesimagesnewsjapan-proposes-reclassifying-crypto-paving-way-for8602c6b51368.jpg … By Cointelegraph 2025-06-24
Cathie Wood’s ARK starts week with fresh $110M Circle stock dump !Cathie Woods ARK starts week with fresh 110M Circle stock dumpimagesnewscathie-woods-ark-starts-week-with-fresh-110m-circlfe84f9fc56a4.jpg Circles … By Cointelegraph 2025-06-24
US housing agency may allow crypto assets in mortgage qualification !US housing agency may allow crypto assets in mortgage qualificationimagesnewsus-housing-agency-may-allow-crypto-assets-in-mortg38ea8a1c6ecc.jpg The … By Cointelegraph 2025-06-24
Turkey tightens crypto rules with source, purpose checks on transfers !Turkey tightens crypto rules with source, purpose checks on transfersimagesnewsturkey-tightens-crypto-rules-with-source-purpose-c723c8fabe5e7.jpg … By Cointelegraph 2025-06-24
Bitcoin makes up one-third of investor crypto portfolios in 2025 !Bitcoin makes up one-third of investor crypto portfolios in 2025imagesnewsbitcoin-makes-up-one-third-of-investor-crypto-port2d95a28e7e00.jpg … By Cointelegraph 2025-06-24
Altcoins Surge on Trump’s Israel-Iran Ceasefire Announcement—But Will it Last? Bitcoin recovered most of the weekends losses due to the Iran-Israel conflictbut questions remain over whether the ceasefire will hold. By Decrypt 2025-06-24
Hardware wallet Ledger launches offline recovery key for new wallets !Hardware wallet Ledger launches offline recovery key for new walletsimagesnewshardware-wallet-ledger-launches-offline-recovery-kb0f80ddceb19.jpg … By Cointelegraph 2025-06-24
Celestia founder dismisses FUD, cites $100M war chest amid backlash !Celestia founder dismisses FUD, cites 100M war chest amid backlashimagesnewscelestia-founder-dismisses-fud-cites-100m-war-ches6189854da86a.jpg … By Cointelegraph 2025-06-24
US Housing Regulator to Study Crypto Holdings in Mortgage Qualification Process FHFA Director Bill Pulte, a longtime crypto supporter, said the agency will examine how digital assets factor into home loan qualification. By Decrypt 2025-06-24
Who is Arthur Britto, the Ripple ‘ghost’ who just broke 14 years of silence? !Who is Arthur Britto, the Ripple ghost who just broke 14 years of … By Cointelegraph 2025-06-24
$4B family office VMS Group to begin investing in crypto: Report !4B family office VMS Group to begin investing in crypto Reportimagesnews4b-family-office-vms-group-to-begin-investing-in-c40890a61e3e6.jpg VMS Group … By Cointelegraph 2025-06-24
Beware: SparkKitty malware wants your seed phrase screenshots !Beware SparkKitty malware wants your seed phrase screenshotsimagesnewsbeware-sparkkitty-malware-wants-your-seed-phrase-sb21f00fb3442.jpg Kaspersky … By Cointelegraph 2025-06-24
Panther Metals up 21% after $5.4M Bitcoin play to buy minerals and gold !Panther Metals up 21 after 5.4M Bitcoin play to buy minerals and goldimagesnewspanther-metals-up-21-after-5-4m-bitcoin-play-to-bu1c41eaa1e022.jpg … By Cointelegraph 2025-06-24
Crypto Scam Markets Thrive Again After Telegram’s Cleanup Attempt: Report Platforms such as Shuangying and Fully Light have surged after the Huione ban, with transactions increasing three to fourfold. By Decrypt 2025-06-24
Fed cuts ‘reputational risk’ scrutiny used to ‘assassinate’ crypto firms !Fed cuts reputational risk scrutiny used to assassinate crypto firmsimagesnewsfed-cuts-reputational-risk-scrutiny-used-to-assassf6360015bd99.jpg … By Cointelegraph 2025-06-24
Israeli Man Accused of Spying for Iran in Exchange for Crypto A Tel Aviv resident allegedly photographed sensitive sites and received thousands in crypto, authorities say. By Decrypt 2025-06-24
Ethereum dev floats halving slot times to 6 secs, doubling blocks !Ethereum dev floats halving slot times to 6 secs, doubling blocksimagesnewsethereum-dev-floats-halving-slot-times-to-6-secs-d529d812eec44.jpg Core … By Cointelegraph 2025-06-24
Pompliano’s crypto firm raises $750M to go public via SPAC !Pomplianos crypto firm raises 750M to go public via SPACimagesnewspomplianos-crypto-firm-raises-750m-to-go-public-via98baa3aec6b.jpg Crypto … By Cointelegraph 2025-06-24
Huione marketplace death sprouts 30 more in its place: Elliptic !Huione marketplace death sprouts 30 more in its place Ellipticimagesnewshuione-marketplace-death-sprouts-30-more-in-its-pl33020009d174.jpg Huione … By Cointelegraph 2025-06-24
Tech That Could Prove Whether Iran’s Uranium Was Destroyed Satellite images reveal damage, but experts suggest that new technology may be able to verify what actually happened underground. By Decrypt 2025-06-24
How AI Is Has Turned Propaganda Into a Potent Weapon AI-generated videos and fake personas are flooding social media from Tel Aviv to Tehran, turning it into a digital battlefield of deception. By Decrypt 2025-06-24
Senator Introduces Bill to Halt Trump’s Crypto Activity—But Voted to Allow It Last Week Adam Schiff D-CA is the latest Democrat to propose a bill banning President Trump from engaging in crypto activity. Like the others, its unlikely to … By Decrypt 2025-06-23
Bitcoin rebounds to $106K amid Middle East ceasefire and rate cut bets !Bitcoin rebounds to 106K amid Middle East ceasefire and rate cut betsimagesnewsbitcoin-rebounds-to-106k-amid-middle-east-ceasefirf3364a142fa2.jpg … By Cointelegraph 2025-06-23
Bitcoin, Ethereum and XRP Spike as Trump Says Iran, Israel Agree to Ceasefire Crypto prices are surging againwith Bitcoin back above 105Kafter President Trump said that Iran and Israel have agreed to a ceasefire. By Decrypt 2025-06-23
Donald Trump and Bitcoin: From 'Not a Fan' to Crypto President—With His Own Meme Coin President Donald Trump used to slam Bitcoin as a scam. Now hes back in the White House and making pro-crypto moves. By Decrypt 2025-06-23
Anchorage adds DeFi capability for institutions with Uniswap wallet integration !Anchorage adds DeFi capability for institutions with Uniswap wallet … By Cointelegraph 2025-06-23
Trump Media says $400M stock buyback won’t affect BTC treasury plans !Trump Media says 400M stock buyback wont affect BTC treasury plansimagesnewstrump-media-says-400m-stock-buyback-wont-affect-bt80eea19dd696.jpg Trump … By Cointelegraph 2025-06-23
Circle stock becomes largest component of VanEck’s digital asset index !Circle stock becomes largest component of VanEcks digital asset indeximagesnewscircle-stock-becomes-largest-component-of-vanecks-17bab032692e.jpg … By Cointelegraph 2025-06-23
Midnight Network Plots NIGHT Airdrop for Users of Bitcoin, Ethereum, Cardano and Beyond Cardano-powered privacy network Midnight will offer NIGHT tokens in an airdrop to millions of crypto users on Bitcoin, Ethereum, and beyond. By Decrypt 2025-06-23
Democratic senator introduces bill to address Trump’s crypto ties !Democratic senator introduces bill to address Trumps crypto tiesimagesnewsdemocratic-senator-introduces-bill-to-address-trumd3603b49d342.jpg The … By Cointelegraph 2025-06-23
Wen Lambo? Jaguar, Land Rover Customizer Revs Up Bitcoin Strategy ECD Automotive Design, which bills itself as the largest Land Rover and Jaguar restorator, has raised half a billion dollars to buy Bitcoin and fund … By Decrypt 2025-06-23
Hyperliquid DEX token gains 300% in 2 months: Is the HYPE justified? !Hyperliquid DEX token gains 300 in 2 months Is the HYPE justified?imagesnewshyperliquid-dex-token-gains-300-in-2-months-is-thec40bc22d7af0.jpg HYPE … By Cointelegraph 2025-06-23
DeFi Development Corp stock to go onchain via Kraken !DeFi Development Corp stock to go onchain via Krakenimagesnewsdefi-development-corp-stock-to-go-onchain-via-krakd3105035c809.jpg The companys CEO … By Cointelegraph 2025-06-23
Price predictions 6/23: SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE !Price predictions 623 SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPEimagesnewsprice-predictions-6-23-spx-dxy-btc-eth-xrp-bnb-sol6df26cfbec17.jpg … By Cointelegraph 2025-06-23
Circle Stock in Up Only Mode Even as Bitcoin, Crypto Market Struggle—Why? Circle stock soared above 298 amid geopolitical chaos as the USDC issuers market cap eclipsed its own stablecoin for the first time. By Decrypt 2025-06-23
Bitcoin Shakes Off Market Chaos as Traders Pile Into Even Riskier Assets: Analysis Meme coins defy macro chaos with explosive gains as Bitcoin and Ethereum trade sideways amid escalating Middle East tensions. By Decrypt 2025-06-23
Coinbase Target Price Raised After ‘Transformative Week’: Benchmark The companys new license in Europe is bullish, along with the GENIUS Acts passage, Benchmark analysts said. By Decrypt 2025-06-23
Trump Media Reaffirms $2.3 Billion Bitcoin Treasury Plan Amid Share Buyback President Trumps publicly traded Trump Media and Technology Group is buying back sharesbut still plans to buy Bitcoin too. By Decrypt 2025-06-23
As stablecoin bill heads to House, Senate shifts to market structure !As stablecoin bill heads to House, Senate shifts to market structureimagesnewsas-stablecoin-bill-heads-to-house-senate-shifts-tofaf795b39ed5.jpg The … By Cointelegraph 2025-06-23
Semiconductor firm Sequans to raise $384M for Bitcoin treasury !Semiconductor firm Sequans to raise 384M for Bitcoin treasuryimagesnewssemiconductor-firm-sequans-to-raise-384m-for-bitco5d03dd991cd5.jpg Roughly … By Cointelegraph 2025-06-23
Bitcoin eyes $104K CME gap as analysis says 'World War 3' off the table !Bitcoin eyes 104K CME gap as analysis says World War 3 off the tableimagesnewsbitcoin-eyes-104k-cme-gap-as-analysis-says-world-wbfd74044264f.jpg … By Cointelegraph 2025-06-23
Pompliano Bitcoin Treasury ProCap Unveils $1 Billion SPAC Merger Instead of simply buying and holding Bitcoin, the company plans on putting capital to work. By Decrypt 2025-06-23
World War Solana Meme Coins Explode in Latest Attention Trend Amid Middle East Tensions Following the United States bombing Iran on Sunday morning, crypto traders pumped some war-related meme coins. By Decrypt 2025-06-23
India wants 30% of your crypto gains, but that’s not the worst part !India wants 30 of your crypto gains, but thats not the worst partimagesnewsindia-wants-30-of-your-crypto-gains-but-thats-not-61d1d4344ddd.jpg A 30 … By Cointelegraph 2025-06-23
Strategy Scales Back Bitcoin Buys as BTC Dips The company bought 245 Bitcoin as tensions escalated in the Middle East. By Decrypt 2025-06-23
Crypto hedge fund execs to raise $100M for BNB treasury vehicle — Report !Crypto hedge fund execs to raise 100M for BNB treasury vehicle Reportimagesnewscrypto-hedge-fund-execs-to-raise-100m-for-bnb-trea5e1e02b6a616.jpg … By Cointelegraph 2025-06-23
Bitcoin supply is shrinking: Will Saylor’s relentless BTC buying cause a supply shock? !Bitcoin supply is shrinking Will Saylors relentless BTC buying cause a supply … By Cointelegraph 2025-06-23
CoinFund-backed Veda raises $18M as stablecoin yield becomes ‘inevitable’ !CoinFund-backed Veda raises 18M as stablecoin yield becomes inevitableimagesnewscoinfund-backed-veda-raises-18m-as-stablecoin-yiel8709747e0114.jpg … By Cointelegraph 2025-06-23
Missiles fly, yet Bitcoin holds, revealing BTC’s strength in global chaos !Missiles fly, yet Bitcoin holds, revealing BTCs strength in global chaosimagesnewsmissiles-fly-yet-bitcoin-holds-revealing-btcs-stre2f6021878829.jpg … By Cointelegraph 2025-06-23
The crypto trap that won’t let you sell — and how to avoid it !The crypto trap that wont let you sell and how to avoid itimagesnewsthe-crypto-trap-that-wont-let-you-sell-and-how-to-b666ef14e6e8.jpg Honeypot … By Cointelegraph 2025-06-23
Bitcoin ASIC producer Canaan pilots US production, exits AI business !Bitcoin ASIC producer Canaan pilots US production, exits AI businessimagesnewsbitcoin-asic-producer-canaan-pilots-us-production-2c6814437f2c.jpg … By Cointelegraph 2025-06-23
How to earn crypto passively without trading !How to earn crypto passively without tradingimagesnewshow-to-earn-crypto-passively-without-trading03a7ef55fd32.jpg Crypto index funds and ETFs can … By Cointelegraph 2025-06-23
Bitcoin, Ethereum Funds Pulled in $1.2 Billion Amid Rising Global Tension Last Week Bitcoin attracts 1.1 billion despite a price correction, while Ethereum posts its longest streak since 2021, data compiled by CoinShares shows. By Decrypt 2025-06-23
Bitcoin becomes less volatile than stocks in the Iran-Israel conflict: Data !Bitcoin becomes less volatile than stocks in the Iran-Israel conflict … By Cointelegraph 2025-06-23
Trezor warns users about phishing emails mimicking customer support !Trezor warns users about phishing emails mimicking customer supportimagesnewstrezor-warns-users-about-phishing-emails-mimicking4d10bd456ab2.jpg … By Cointelegraph 2025-06-23
Teen Has 'Strong Incentives to Flee' After Pleading Guilty to $245M Bitcoin Heist, Gov Says The government argued that Veer Chatels co-conspirators could help him to flee the country to prevent him testifying against them. By Decrypt 2025-06-23
Investor makes nearly $30M from Bitcoin bought in 2013 !Investor makes nearly 30M from Bitcoin bought in 2013imagesnewsinvestor-makes-nearly-30m-from-bitcoin-bought-in-25034620f9b43.jpg The savvy Bitcoin … By Cointelegraph 2025-06-23
Strategy buys $26M Bitcoin as prices bleed on geopolitical fears !Strategy buys 26M Bitcoin as prices bleed on geopolitical fearsimagesnewsstrategy-buys-26m-bitcoin-as-prices-bleed-on-geopodf41e1ab1aa7.jpg Michael … By Cointelegraph 2025-06-23
Is XRP price going to crash again? !Is XRP price going to crash again?imagesnewsis-xrp-price-going-to-crash-againcc9ee6097de4.jpg XRP price risks a possible 41 plunge to 1.18 if a … By Cointelegraph 2025-06-23
Metaplanet’s Symbolic 1,111 Bitcoin Buy Puts it at 10% of 2026 Target The Japanese firm has achieved 11 of its ambitious 100,000 BTC goal for 2026 following its latest Bitcoin purchase. By Decrypt 2025-06-23
Bitcoin treasury trend is new altseason for crypto speculators: Adam Back !Bitcoin treasury trend is new altseason for crypto speculators Adam Backimagesnewsbitcoin-treasury-trend-is-new-altseason-for-cryptob5226497e3cd.jpg … By Cointelegraph 2025-06-23
Metaplanet adds 1,111 Bitcoin, approaches Tesla’s BTC holdings !Metaplanet adds 1,111 Bitcoin, approaches Teslas BTC holdingsimagesnewsmetaplanet-adds-1111-bitcoin-approaches-teslas-btc6ae47a896190.jpg Metaplanet … By Cointelegraph 2025-06-23
Crypto funds post $1.2B inflows despite market panic: CoinShares !Crypto funds post 1.2B inflows despite market panic CoinSharesimagesnewscrypto-funds-post-1-2b-inflows-despite-market-pani0376d29b8fe7.jpg ETP … By Cointelegraph 2025-06-23
Ethereum whales open $100M of leveraged bets after US strikes Iran !Ethereum whales open 100M of leveraged bets after US strikes Iranimagesnewsethereum-whales-open-100m-of-leveraged-bets-after-eacc54ff86f4.jpg Whales … By Cointelegraph 2025-06-23
$92K dip vs ‘short-lived war’ — 5 things to know in Bitcoin this week !92K dip vs short-lived war 5 things to know in Bitcoin this weekimagesnews92k-dip-vs-short-lived-war-5-things-to-know-in-bit0151c007bcff.jpg … By Cointelegraph 2025-06-23
How low can the Bitcoin price go? !How low can the Bitcoin price go?imagesnewshow-low-can-the-bitcoin-price-go6a94ca2d5f28.jpg Bitcoin dipped below 100,000 for the first time in six … By Cointelegraph 2025-06-23
OKX crypto exchange considering US IPO after local relaunch: Report !OKX crypto exchange considering US IPO after local relaunch Reportimagesnewsokx-crypto-exchange-considering-us-ipo-after-local1fb9a8d5c3b8.jpg OKXs … By Cointelegraph 2025-06-23
Musk wants Grok AI to ‘rewrite the entire corpus of human knowledge’ !Musk wants Grok AI to rewrite the entire corpus of human knowledgeimagesnewsmusk-wants-grok-ai-to-rewrite-the-entire-corpus-ofe526d86623be.jpg Elon … By Cointelegraph 2025-06-23
FTX rejects 3AC’s $1.5B claim, citing ‘failed trading strategy’ !FTX rejects 3ACs 1.5B claim, citing failed trading strategyimagesnewsftx-rejects-3acs-1-5b-claim-citing-failed-trading-dba291b47878.jpg FTX lawyers … By Cointelegraph 2025-06-23
Crypto Exchange OKX Plans to Go Public in the US: Report Broader interest in the crypto industry to capitalize on favorable U.S. market conditions is taking root, following Circles IPO this month. By Decrypt 2025-06-23
$5.1B Cardone Capital buys 1,000 Bitcoin, eyes another 3,000 BTC !5.1B Cardone Capital buys 1,000 Bitcoin, eyes another 3,000 BTCimagesnews5-1b-cardone-capital-buys-1000-bitcoin-eyes-anothefe676837eff9.jpg Grant … By Cointelegraph 2025-06-23
Coinbase Secures MiCA License, Expanding Crypto Services Across EU Approval from Luxembourg grants Coinbase access to 27 EU countries, raising questions about regulation shopping in smaller member states. By Decrypt 2025-06-23
Saylor hints next Bitcoin buy as investor sues over Strategy’s Q1 loss !Saylor hints next Bitcoin buy as investor sues over Strategys Q1 lossimagesnewssaylor-hints-next-bitcoin-buy-as-investor-sues-ove07bb73d27117.jpg … By Cointelegraph 2025-06-23
Bitcoin ‘weakness shall pass’ after dip below $100K: Arthur Hayes !Bitcoin weakness shall pass after dip below 100K Arthur Hayesimagesnewsbitcoin-weakness-shall-pass-after-dip-below-100k-a087afada7614.jpg Bitcoin … By Cointelegraph 2025-06-23
Cointelegraph Website Hacked in Fake Airdrop Phishing Attack Cointelegraph is the latest in a wave of phishing attacks targeting crypto platforms via exploits that lure users with fake token rewards. By Decrypt 2025-06-23
Texas Joins Growing List of US States With Bitcoin Reserves Texas has become the third U.S. state to approve a public Bitcoin reserve, with new legislation allowing direct crypto purchases. By Decrypt 2025-06-23
Hacken token plunges 99% after hacker mints and dumps $250K !Hacken token plunges 99 after hacker mints and dumps 250Kimagesnewshacken-token-plunges-99-after-hacker-mints-and-dumed173068582d.jpg Cybersecurity … By Cointelegraph 2025-06-23
Bitcoin Rebounds as Markets Price in 'Short-Lived' Iran Conflict Bitcoin rose back above 100,000 as markets shrugged off U.S. strikes on Iran, with oil and equities remaining largely unchanged. By Decrypt 2025-06-23
Traders watch XRP, ETH, SOL and HYPE now that Bitcoin trades below $100K !Traders watch XRP, ETH, SOL and HYPE now that Bitcoin trades below 100Kimagesnewstraders-watch-xrp-eth-sol-and-hype-now-that-bitcoiabbf922e3433.jpg … By Cointelegraph 2025-06-22
This Week in Crypto Games: B3's Self-Destruct PC, Avalanche Battle Pass Ethereum gaming protocol B3 is launching a PC with self-destruct storage, Avalanche dropped a battle pass with rewards for players, and more. By Decrypt 2025-06-22
7 Classic Video Games That Defined Their Consoles From analog sticks to motion controls, these are the games that didnt just launch on a console they defined what it could do. By Decrypt 2025-06-22
Ethereum whale stacks $39M despite ETH falling harder than Bitcoin !Ethereum whale stacks 39M despite ETH falling harder than Bitcoinimagesnewsethereum-whale-stacks-39m-despite-eth-falling-hard7f1e314fd9df.jpg … By Cointelegraph 2025-06-22
Intents fix crypto's UX crisis and pave the way for agentic DeFi !Intents fix cryptos UX crisis and pave the way for agentic DeFiimagesnewsintents-fix-crypto-s-ux-crisis-and-pave-the-way-fob2966e354ef8.jpg Intents … By Cointelegraph 2025-06-22
Bitcoin Plunges Below $100K as XRP and Dogecoin Prices Hit 2-Month Lows Following U.S. strikes on Iran nuclear facilities, crypto prices are falling harder, with Bitcoin diving below 100K and Ethereum down 10. By Decrypt 2025-06-22
Break Singapore’s new crypto rules and you could face $200K fine or jail !Break Singapores new crypto rules and you could face 200K fine or jailimagesnewsbreak-singapores-new-crypto-rules-and-you-could-fa44d167083938.jpg … By Cointelegraph 2025-06-22
Lummis’ RISE Act is ‘timely and needed’ but short on details !Lummis RISE Act is timely and needed but short on detailsimagesnewslummis-rise-act-is-timely-and-needed-but-short-on-ee903d5d4829.jpg Senator Lummis … By Cointelegraph 2025-06-22
Which Crypto IPOs Could Be Next Following Circle? Following Circles hugely successful IPO, big names in the crypto industry are preparing listings as investor demand soars. By Decrypt 2025-06-22
Despite Trump’s backing, crypto is choosing MiCA over America: Paybis !Despite Trumps backing, crypto is choosing MiCA over America Paybisimagesnewsdespite-trumps-backing-crypto-is-choosing-mica-ove47216969d64d.jpg … By Cointelegraph 2025-06-22
Bitcoin price risks sub-$100K dive after Trump confirms Iran strikes !Bitcoin price risks sub-100K dive after Trump confirms Iran strikesimagesnewsbitcoin-price-risks-sub-100k-dive-after-trump-conf38f1f48f766b.jpg BTC … By Cointelegraph 2025-06-22
Texas governor signs bill adding Bitcoin to official reserves !Texas governor signs bill adding Bitcoin to official reservesimagesnewstexas-governor-signs-bill-adding-bitcoin-to-officie092616bb45b.jpg Texas … By Cointelegraph 2025-06-22
Crypto Market Liquidations Top $701M as US Strikes Hit Iran's Nuclear Facilities Ethereum led the crypto market selloff Sunday morning, after U.S. President Donald Trump ordered strikes on three Iranian nuclear facilities. By Decrypt 2025-06-22
Signal trading ‘school’ and fake exchange rob investor of $860K: Lawsuit !Signal trading school and fake exchange rob investor of 860K Lawsuitimagesnewssignal-trading-school-and-fake-exchange-rob-invest722ca3cf671c.jpg A … By Cointelegraph 2025-06-22
Michael Saylor’s Strategy premium is not ‘unreasonable’: Adam Back !Michael Saylors Strategy premium is not unreasonable Adam Backimagesnewsmichael-saylors-strategy-premium-is-not-unreasonabf7e63303afca.jpg Adam Back … By Cointelegraph 2025-06-22
Samson Mow wants Bitcoin in ‘all of Europe,’ receives invite to France !Samson Mow wants Bitcoin in all of Europe, receives invite to Franceimagesnewssamson-mow-wants-bitcoin-in-all-of-europe-receives2a57ba237fbf.jpg … By Cointelegraph 2025-06-22
Cathie Wood's ARK dumps $146M in Circle amid share surge !Cathie Woods ARK dumps 146M in Circle amid share surgeimagesnewscathie-wood-s-ark-dumps-146m-in-circle-amid-share-2f1884de97a3.jpg Despite the … By Cointelegraph 2025-06-21
'Public Good': Wyoming Plots August Debut for WYST Stablecoin The Wyoming Stable Token Commission is targeting an August launch for its state stablecoin following years of preparation. By Decrypt 2025-06-21
Strategy’s Michael Saylor raises Bitcoin forecast to $21M by 2046 !Strategys Michael Saylor raises Bitcoin forecast to 21M by 2046imagesnewsstrategys-michael-saylor-raises-bitcoin-forecast-t30c0f445180e.jpg Michael … By Cointelegraph 2025-06-21
Historical Bitcoin trend calls for $330K BTC price before bull market ends !Historical Bitcoin trend calls for 330K BTC price before bull market … By Cointelegraph 2025-06-21
How 'MapleStory N' Is Fighting Back Against Thousands of Hackers MapleStory N is banning thousands of hackers a day, as abusers try to make a quick buck off the Avalanche blockchain game. By Decrypt 2025-06-21
SOL price drop to $120 looks likely, but there’s a silver lining !SOL price drop to 120 looks likely, but theres a silver liningimagesnewssol-price-drop-to-120-looks-likely-but-theres-a-si46631882b65e.jpg A … By Cointelegraph 2025-06-21
From Free NFT Mint to Drinks at 7-Eleven: Rekt Is Reaching the Masses Rekt began life as free Ethereum NFT drop and now is a rising drink brand, with cans hitting 7-Eleven stores this week. By Decrypt 2025-06-21
Bitcoin Knots gain ground: Will a chain split kill BTC price? !Bitcoin Knots gain ground Will a chain split kill BTC price?imagesnewsbitcoin-knots-gain-ground-will-a-chain-split-kill-44279153a161.jpg A massive … By Cointelegraph 2025-06-21
Elliptic, Internet Watch Foundation Team Up to Combat Crypto Financing of Child Abuse Material The Internet Watch Foundation found that cryptocurrencies are the most commonly offered method of payment on child abuse websites. By Decrypt 2025-06-21
‘Policy procrastination’ leaves UK trailing EU, US in crypto regulation: Experts !Policy procrastination leaves UK trailing EU, US in crypto regulation … By Cointelegraph 2025-06-21
XRP price rally’s biggest earners are selling $68.5M tokens every day !XRP price rallys biggest earners are selling 68.5M tokens every dayimagesnewsxrp-price-rallys-biggest-earners-are-selling-68-5mdbb053165dee.jpg XRP … By Cointelegraph 2025-06-21
ZachXBT slams Bitcoin bridge Garden Finance for laundering hacked funds !ZachXBT slams Bitcoin bridge Garden Finance for laundering hacked fundsimagesnewszachxbt-slams-bitcoin-bridge-garden-finance-for-la444f899694e3.jpg … By Cointelegraph 2025-06-21
Nakamoto Holdings secures $51.5M to expand Bitcoin treasury strategy !Nakamoto Holdings secures 51.5M to expand Bitcoin treasury strategyimagesnewsnakamoto-holdings-secures-51-5m-to-expand-bitcoin-77b1fe7551c7.jpg … By Cointelegraph 2025-06-21
Crypto cycle is playing out ‘spookily similar’ to 2017: Raoul Pal !Crypto cycle is playing out spookily similar to 2017 Raoul Palimagesnewscrypto-cycle-is-playing-out-spookily-similar-to-20a1a7f9dfafdf.jpg Real … By Cointelegraph 2025-06-21
CoinMarketCap has 'identified and removed' malicious wallet scam !CoinMarketCap has identified and removed malicious wallet scamimagesnewscoinmarketcap-has-identified-and-removed-maliciousd2e94d6a685f.jpg According … By Cointelegraph 2025-06-21
Bitcoin in a post-Trump world worries hedge fund execs: Eric Semler !Bitcoin in a post-Trump world worries hedge fund execs Eric Semlerimagesnewsbitcoin-in-a-post-trump-world-worries-hedge-fund-e68eee40d9823.jpg Eric … By Cointelegraph 2025-06-21
Bitcoin futures premium falls to 3-month low despite strong BTC ETF inflows !Bitcoin futures premium falls to 3-month low despite strong BTC ETF … By Cointelegraph 2025-06-21
Solana, XRP and Dogecoin ETF Approvals in 2025 Are a Near Lock, Analysts Say Wall Street analysts say that SEC approvals for ETFs based on altcoins including Dogecoin, XRP, and Solana are nearly a sure thing this year. By Decrypt 2025-06-20
Reddit weighs World’s scanning orbs for user verification — Report !Reddit weighs Worlds scanning orbs for user verification Reportimagesnewsreddit-weighs-worlds-scanning-orbs-for-user-verifi092b710d147b.jpg Many … By Cointelegraph 2025-06-20
Thai SEC opens consultation period for token issuance rules !Thai SEC opens consultation period for token issuance rulesimagesnewsthai-sec-opens-consultation-period-for-token-issuaec2117c33e48.jpg The … By Cointelegraph 2025-06-20
Nakamoto Holdings Rakes in $51.5 Million for Publicly Traded Bitcoin Treasury The Bitcoin holdings companys merger partner KindlyMD closed the 51.5 million fundraise with private investors on Friday. By Decrypt 2025-06-20
Public Keys: Circle and Coinbase Get GENIUS Bump, Bitcoin Treasuries on Shaky Ground? Circle skyrockets on stablecoin optimism while Bitcoin treasury firms face valuation challenges in this weeks public markets roundup. By Decrypt 2025-06-20
Bitcoin’s $96B open interest shows role leverage plays in rallies, but there is a risk !Bitcoins 96B open interest shows role leverage plays in rallies, but there is a … By Cointelegraph 2025-06-20
Norway’s government explores crypto mining ban amid energy supply concerns !Norways government explores crypto mining ban amid energy supply … By Cointelegraph 2025-06-20
Crypto Biz: AI money rush could reshape digital asset industry !Crypto Biz AI money rush could reshape digital asset industryimagesnewscrypto-biz-ai-money-rush-could-reshape-digital-asse7fa74aa00b9.jpg … By Cointelegraph 2025-06-20
US crypto ETF approval odds surge to ‘90% or higher’ — Bloomberg analysts !US crypto ETF approval odds surge to 90 or higher Bloomberg analystsimagesnewsus-crypto-etf-approval-odds-surge-to-90-or-higher-e821f55440c3.jpg … By Cointelegraph 2025-06-20
Bitcoin, Dogecoin Targeted as Norway Eyes Ban on New Crypto Mining Operations The government said it will explore the possibility of temporarily prohibiting the establishment of new data centers in Norway that extract … By Decrypt 2025-06-20
Crypto user attacked in France over Ledger hardware wallet — Report !Crypto user attacked in France over Ledger hardware wallet Reportimagesnewscrypto-user-attacked-in-france-over-ledger-hardwar4760f3226edb.jpg The … By Cointelegraph 2025-06-20
Texas Sheriffs Crack Bitcoin ATM With Power Tools to Retrieve $32,000 Jasper County Sheriff Chuck Havard told Decrypt that authorities have likely accessed the machines before. By Decrypt 2025-06-20
Wyoming stablecoin commission names Aptos highest-ranking blockchain !Wyoming stablecoin commission names Aptos highest-ranking blockchainimagesnewswyoming-stablecoin-commission-names-aptos-highest-c73856b0febf.jpg The … By Cointelegraph 2025-06-20
Bitcoin Cools, But Forks Are on Fire as BCH and BSV Torch the Charts: Analysis While Bitcoin dozes near 103K, Bitcoin Cash and Bitcoin SV are on the rise, upstaging the flagship coin as traders chase double-digit gains. By Decrypt 2025-06-20
Price predictions 6/20: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, SUI !Price predictions 620 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, BCH, SUIimagesnewsprice-predictions-6-20-btc-eth-xrp-bnb-sol-doge-add82c63354c58.jpg … By Cointelegraph 2025-06-20
Coinbase secures MiCA license, names Luxembourg as EU headquarters !Coinbase secures MiCA license, names Luxembourg as EU headquartersimagesnewscoinbase-secures-mica-license-names-luxembourg-as-4229545e2d2c.jpg … By Cointelegraph 2025-06-20
Staked Ether hits record high driven by corporate crypto treasury adoption: Finance Redefined !Staked Ether hits record high driven by corporate crypto treasury adoption Finance … By Cointelegraph 2025-06-20
Bitcoin should hold $100K as Q3 seasonality predicts sideways trading !Bitcoin should hold 100K as Q3 seasonality predicts sideways tradingimagesnewsbitcoin-should-hold-100k-as-q3-seasonality-predict62fdfb4963a5.jpg … By Cointelegraph 2025-06-20
Myriad Moves: Will Bitcoin Set a New All-Time High? Plus Strategy and PENGU Predictions Will Bitcoins next move be a spike to a fresh all-time high price, or a sharp plunge? Myriad users make their predictions on this and more. By Decrypt 2025-06-20
Uber pitches AI labeling services following Meta’s Scale acquisition — Report !Uber pitches AI labeling services following Metas Scale acquisition … By Cointelegraph 2025-06-20
Bitcoin rally to $120K possible if Fed eases rates due to tariff and war impact !Bitcoin rally to 120K possible if Fed eases rates due to tariff and war … By Cointelegraph 2025-06-20
Kraken moves HQ to Wyoming, cites regulatory environment !Kraken moves HQ to Wyoming, cites regulatory environmentimagesnewskraken-moves-hq-to-wyoming-cites-regulatory-enviro3ce15902cb50.jpg The crypto … By Cointelegraph 2025-06-20
China to Restore Classic Bruce Lee, Jackie Chan and Jet Li Movies Using AI China invests 14M in AI to restore 100 classic kung fu films, reviving Bruce Lee and Jackie Chan movies for global cultural influence. By Decrypt 2025-06-20
CRYPTO EDGES HIGHER, TRUMP FAMILY REDUCES WLFI STAKE, PUMPFUN TOKEN DELAYED! CRYPTO EDGES HIGHER, TRUMP FAMILY REDUCES WLFI STAKE, PUMPFUN TOKEN DELAYED! FOMO HOUR LIVE ON DEGENZ. Degenz Live is the only content you need for … By Decrypt 2025-06-20
Bitcoin price 'trending back' but new highs before July unlikely: Analysis !Bitcoin price trending back but new highs before July unlikely Analysisimagesnewsbitcoin-price-trending-back-but-new-highs-before-jc81495e35ce6.jpg … By Cointelegraph 2025-06-20
Tokenized Assets ‘Expand Participation in Equity’ and Bring Wall Street On-Chain: Exodus Blockchain paves the way for 247 trades and lightning-fast settlement, the self-custodial crypto platform told Decrypt. By Decrypt 2025-06-20
Bitcoin Holds Ground as Fed’s Waller Calls for July Rate Cut Fed futures traders penciled in a 14 chance that the U.S. central bank would cut rates in July on Friday. By Decrypt 2025-06-20
Bitcoin price slips under $104K into 'triple witching' options expiry !Bitcoin price slips under 104K into triple witching options expiryimagesnewsbitcoin-price-slips-under-104k-into-triple-witchin13c07849fd13.jpg … By Cointelegraph 2025-06-20
High risk, high reward: Crypto perpetual futures gain momentum in US !High risk, high reward Crypto perpetual futures gain momentum in USimagesnewshigh-risk-high-reward-crypto-perpetual-futures-gaif37079d649bb.jpg … By Cointelegraph 2025-06-20
The SEC’s staking guidance pivot is what tech-savvy regulation looks like !The SECs staking guidance pivot is what tech-savvy regulation looks likeimagesnewsthe-secs-staking-guidance-pivot-is-what-tech-savvyfd181616e718.jpg … By Cointelegraph 2025-06-20
USDC Issuer Circle Spikes After Wall Street Firm Initiates With Buy Rating Circle stock jumps 14 as stablecoin legislation passes Senate and Wall Street analyst predicts 2T market growth for the USDC issuer. By Decrypt 2025-06-20
Korean biotech firm bought by Parataxis for Bitcoin treasury use !Korean biotech firm bought by Parataxis for Bitcoin treasury useimagesnewskorean-biotech-firm-bought-by-parataxis-for-bitcoi879d8504d5e2.jpg … By Cointelegraph 2025-06-20
$330K Bitcoin block win: How one solo miner outsmarted the odds !330K Bitcoin block win How one solo miner outsmarted the odds imagesnews330k-bitcoin-block-win-how-one-solo-miner-outsmart920ebaca8b9f.jpg Against 1 … By Cointelegraph 2025-06-20
‘Users Need Safety’: Former SpaceX Manager Raises $4.2M for Crypto Platform Stackup Using account abstraction, businesses can avoid catastrophic failures on-chain, said Stackup co-founder and CEO John Rising. By Decrypt 2025-06-20
South Korean young people turning to crypto out of desperation !South Korean young people turning to crypto out of desperationimagesnewssouth-korean-young-people-turning-to-crypto-out-ofbe5780257a12.jpg A local … By Cointelegraph 2025-06-20
Solana DEX Jupiter suspends DAO voting until 2026 to focus on DeFi growth !Solana DEX Jupiter suspends DAO voting until 2026 to focus on DeFi … By Cointelegraph 2025-06-20
Former Celsius CEO Alex Mashinsky Forfeits All Claims to Bankruptcy Proceeds The agreement blocks Mashinsky from receiving any recovery in the Celsius bankruptcy, allowing for more funds to be distributed to creditors. By Decrypt 2025-06-20
TikTok Hits Back At Congressman's '$300 Million Bribe' Accusation Over Trump Meme Coin Congressman Brad Sherman accused TikToks owners of bribing President Trump by purchasing his official meme coin. By Decrypt 2025-06-20
Bitcoin as corporate treasury: Why Meta, Amazon and Microsoft all said no !Bitcoin as corporate treasury Why Meta, Amazon and Microsoft all said no … By Cointelegraph 2025-06-20
How to use ChatGPT to turn crypto news into trade signals !How to use ChatGPT to turn crypto news into trade signalsimagesnewshow-to-use-chatgpt-to-turn-crypto-news-into-trade-37fe4984645f.jpg Crypto traders … By Cointelegraph 2025-06-20
XRP onchain data shows why $3 is out of reach for now !XRP onchain data shows why 3 is out of reach for nowimagesnewsxrp-onchain-data-shows-why-3-is-out-of-reach-for-n82ca9ae0c573.jpg XRP price struggles … By Cointelegraph 2025-06-20
BlackRock ETF scoops up 3.25% of Bitcoin supply as ‘new money’ dries up !BlackRock ETF scoops up 3.25 of Bitcoin supply as new money dries upimagesnewsblackrock-etf-scoops-up-3-25-of-bitcoin-supply-as-00156660ead7.jpg … By Cointelegraph 2025-06-20
Death, divorce and lost keys: The question of succession in tokenized property !Death, divorce and lost keys The question of succession in tokenized … By Cointelegraph 2025-06-20
Blockdaemon launches non-custodial staking and DeFi stack for institutions !Blockdaemon launches non-custodial staking and DeFi stack for … By Cointelegraph 2025-06-20
Bitcoin grabs $106K liquidity as whale longs BTC with $255M !Bitcoin grabs 106K liquidity as whale longs BTC with 255Mimagesnewsbitcoin-grabs-106k-liquidity-as-whale-longs-btc-wi45d687fc3d90.jpg Bitcoin sees a … By Cointelegraph 2025-06-20
TikTok denies TRUMP memecoin buys in reply to congressman’s accusations !TikTok denies TRUMP memecoin buys in reply to congressmans accusationsimagesnewstiktok-denies-trump-memecoin-buys-in-reply-to-cong2df20131134f.jpg … By Cointelegraph 2025-06-20
SEC Thailand Opens Public Consultation on Crypto Listing Criteria Thailands SEC has opened public feedback on new rules letting exchanges list self-issued tokens, with stronger disclosure requirements. By Decrypt 2025-06-20
South Korean Regulators Prepare for Spot Crypto ETFs This Year The countrys financial regulator has submitted plans to launch crypto ETFs and won-based stablecoins by the second half of this year. By Decrypt 2025-06-20
South Korea’s central bank won’t oppose stablecoin: Report !South Koreas central bank wont oppose stablecoin Reportimagesnewssouth-koreas-central-bank-wont-oppose-stablecoin-r5252236d2bce.jpg The head of … By Cointelegraph 2025-06-20
Texas cops cut open crypto ATM to recover $25K lost to scam !Texas cops cut open crypto ATM to recover 25K lost to scamimagesnewstexas-cops-cut-open-crypto-atm-to-recover-25k-lost321126544a86.jpg Pictures show … By Cointelegraph 2025-06-20
North Korea Targets Crypto Professionals With New Malware in Hiring Scams Hackers linked to Pyongyang are posing as Coinbase and Uniswap recruiters to deploy PylangGhost, a Python-based trojan. By Decrypt 2025-06-20
Politicians’ memecoins, dropped court cases fuel crypto ‘crime supercycle’ !Politicians memecoins, dropped court cases fuel crypto crime supercycleimagesnewspoliticians-memecoins-dropped-court-cases-fuel-cry26d2d31b2a01.jpg … By Cointelegraph 2025-06-20
Semler Scientific Targets Hefty Bitcoin Stash Over Next 2 Years Once a cautious believer in crypto, Semler Scientific is now racing to become the second-largest corporate holder of Bitcoin. By Decrypt 2025-06-20
Apple eyes generative AI to speed up custom chip design: Report !Apple eyes generative AI to speed up custom chip design Reportimagesnewsapple-eyes-generative-ai-to-speed-up-custom-chip-d590554be8c7c.jpg Apple may … By Cointelegraph 2025-06-20
Arizona Senate Passes Bitcoin Reserve Bill for Seized Crypto, Heads to House For Debate The bill seeks to establish a state-managed digital asset fund using crypto seized through criminal forfeiture. By Decrypt 2025-06-20
Arizona Senate revives Bitcoin reserve bill after reconsideration vote !Arizona Senate revives Bitcoin reserve bill after reconsideration voteimagesnewsarizona-senate-revives-bitcoin-reserve-bill-after-46af2a5901d7.jpg … By Cointelegraph 2025-06-20
North Korea targets crypto workers with new info-stealing malware !North Korea targets crypto workers with new info-stealing malwareimagesnewsnorth-korea-targets-crypto-workers-with-new-info-se122a36f1e62.jpg North … By Cointelegraph 2025-06-20
Bitcoiners split on $94K or $114K for BTC’s next move as it trades sideways !Bitcoiners split on 94K or 114K for BTCs next move as it trades sidewaysimagesnewsbitcoiners-split-on-94k-or-114k-for-btcs-next-movefd2460e16fa4.jpg … By Cointelegraph 2025-06-20
Bitcoin sentiment at ‘peak FUD’ with divide between bears and bulls — Santiment !Bitcoin sentiment at peak FUD with divide between bears and bulls … By Cointelegraph 2025-06-20
Massive Data Breach Hits Billions of Logins Across Google, Facebook and GitHub A data breach including over 16 billion passwords has sent a shockwave through the tech world as users scramble to protect themselves. By Decrypt 2025-06-20
Semler Scientific plans Bitcoin holdings of 105,000 BTC by 2027 !Semler Scientific plans Bitcoin holdings of 105,000 BTC by 2027imagesnewssemler-scientific-plans-bitcoin-holdings-of-105000aba9bf37d1d0.jpg Health … By Cointelegraph 2025-06-20
Hyperliquid Token Hits 10-Day Low Following Recent Record High Analysts told Decrypt that the dip may represent a reaction to recent corporate treasury buy-ins and a decline in trading volume. By Decrypt 2025-06-19
Polymarket gives US stablecoin bill 89% chance of becoming law !Polymarket gives US stablecoin bill 89 chance of becoming lawimagesnewspolymarket-gives-us-stablecoin-bill-89-chance-of-b7e8d1c5c5cc9.jpg The … By Cointelegraph 2025-06-19
XBTO, Arab Bank Switzerland launch BTC yield product for institutional clients !XBTO, Arab Bank Switzerland launch BTC yield product for institutional … By Cointelegraph 2025-06-19
Telegram Boss Pavel Durov Temporarily Permitted to Leave France: Report The crypto-friendly apps boss was arrested in France last year and is under investigation. By Decrypt 2025-06-19
Bitcoin ‘weak hands’ sell 15K BTC at a loss: Are BTC lows under $100K next? !Bitcoin weak hands sell 15K BTC at a loss Are BTC lows under 100K next?imagesnewsbitcoin-weak-hands-sell-15k-btc-at-a-loss-are-btc-9ef63740d3ac.jpg … By Cointelegraph 2025-06-19
AI Infrastructure Firm Gradient Bags $10 Million to Develop Protocols on Solana Pantera and Multicoin Capital lead the funding for startup creating peer-to-peer protocols Lattica and Parallax, aiming to distribute AI computing … By Decrypt 2025-06-19
Kraken Debuts Bitcoin Staking With BABY Token Rewards Staked Bitcoin rewards will be paid in BABY, Babylons native token, the crypto exchange said. By Decrypt 2025-06-19
Musk’s X plans payments, investment features rollout for 2025 — Report !Musks X plans payments, investment features rollout for 2025 Reportimagesnewsmusks-x-plans-payments-investment-features-rollout7091693e661f.jpg The … By Cointelegraph 2025-06-19
Trump Family Reduces Stake in Crypto Project World Liberty DT Marks DEFI LLC recently reduced its ownership share in the company from 60 to approximately 40. By Decrypt 2025-06-19
Crypto Exchange Token a Surprise Winner as Bitcoin, ETH and XRP Stay Flat: Analysis Bulls and bears clash over technical signals as crypto markets remain mostly unchanged todaywith a couple exceptions. By Decrypt 2025-06-19
OpenAI cuts ties with Scale AI amid data labeler’s new Meta deal — Report !OpenAI cuts ties with Scale AI amid data labelers new Meta deal Reportimagesnewsopenai-cuts-ties-with-scale-ai-amid-data-labelers-bf81b8b83093.jpg … By Cointelegraph 2025-06-19
ESA Predicts Humans Living in ‘Space Oases’ on Mars in 2040 The European Space Agencys Technology 2040 Vision document explores what the future of space exploration could look like. By Decrypt 2025-06-19
Trump family’s company cuts stake in World Liberty Financial by 20% — Report !Trump familys company cuts stake in World Liberty Financial by 20 … By Cointelegraph 2025-06-19
Neobank Revolut Actively Exploring Launching Its Own Stablecoin: Sources The London neobank is in talks with at least one crypto-native company as it considers launching a stablecoin. By Decrypt 2025-06-19
Visa, Yellow Card push digital dollar use across African countries !Visa, Yellow Card push digital dollar use across African countriesimagesnewsvisa-yellow-card-push-digital-dollar-use-across-af9062a6ea5065.jpg … By Cointelegraph 2025-06-19
Nasdaq-Listed Healthcare Firm Opens Bitcoin Treasury With $20 Million BTC Buy Publicly-traded health sciences company Prenetics joins a growing list of companies adopting a Bitcoin treasury strategy. By Decrypt 2025-06-19
Telegram's Pavel Durov approved to leave France temporarily !Telegrams Pavel Durov approved to leave France temporarilyimagesnewstelegram-s-pavel-durov-approved-to-leave-france-te7b2a91396a15.jpg The Telegram … By Cointelegraph 2025-06-19
How Will Bitcoin Defend Against Quantum Computing? This Project Just Raised $6M Project 11 is working on protecting the leading crypto network against the potential threat. By Decrypt 2025-06-19
Musk's X to Debut Trading and Payment System. But Where is Dogecoin? Musks X Money will soon roll out the feature, according to an FT report, but no sign yet of crypto integration, including Dogecoin. By Decrypt 2025-06-19
Bitcoin Sidechain Plasma Eyes 'Late Summer' Mainnet Launch Following Massive ICO Plasma is aiming to create stablecoin chain number one after securing 1 billion in deposits for its upcoming XPL token pre-sale. By Decrypt 2025-06-19
Ethereum bulls must break $2.8K: What will trigger a 'violent move'? !Ethereum bulls must break 2.8K What will trigger a violent move?imagesnewsethereum-bulls-must-break-2-8k-what-will-trigger-af4707ad2f386.jpg … By Cointelegraph 2025-06-19
How crypto experts find 100x coins before anyone else !How crypto experts find 100x coins before anyone elseimagesnewshow-crypto-experts-find-100x-coins-before-anyone-ede488bbe5334.jpg Trendspotting in … By Cointelegraph 2025-06-19
CIRCLE STOCKS PUMPS, TRUMP WAITING ON IRAN ACTION, FED TO WAIT & SEE CIRCLE STOCKS PUMPS, TRUMP WAITING ON IRAN ACTION, FED TO WAIT SEE. FOMO HOUR LIVE ON DEGENZ. Degenz Live is the only content you need for crypto, … By Decrypt 2025-06-19
Here’s what Bitcoin did while the US added to its $37T debt !Heres what Bitcoin did while the US added to its 37T debtimagesnewsheres-what-bitcoin-did-while-the-us-added-to-its-3ece7a314fbc8.jpg As Washington … By Cointelegraph 2025-06-19
Crypto's true revolution is about humanity, not technology !Cryptos true revolution is about humanity, not technologyimagesnewscrypto-s-true-revolution-is-about-humanity-not-tec05c02e2af00c.jpg Crypto isnt … By Cointelegraph 2025-06-19
Solana Will Flip Ethereum, Anthony Scaramucci Predicts The SkyBridge Capital founder is leaning into Solanas Ethereum killer narrativeand going against Standard Chartereds recent prediction. By Decrypt 2025-06-19
Bitcoin volume metric suggests '$130K-$135K BTC will happen' in the summer !Bitcoin volume metric suggests 130K-135K BTC will happen in the summerimagesnewsbitcoin-volume-metric-suggests-130k-135k-btc-will-391244637a59.jpg A … By Cointelegraph 2025-06-19
Here's when Bitcoin analysts expect new BTC price volatility !Heres when Bitcoin analysts expect new BTC price volatilityimagesnewshere-s-when-bitcoin-analysts-expect-new-btc-price-7441b75d7c5e.jpg Bitcoin may … By Cointelegraph 2025-06-19
There’s more to crypto crime than meets the eye: What you need to know !Theres more to crypto crime than meets the eye What you need to knowimagesnewstheres-more-to-crypto-crime-than-meets-the-eye-wha28a6681cf092.jpg … By Cointelegraph 2025-06-19
Kraken launches Bitcoin staking with Babylon integration !Kraken launches Bitcoin staking with Babylon integrationimagesnewskraken-launches-bitcoin-staking-with-babylon-integaa1cf6f85818.jpg Kraken has … By Cointelegraph 2025-06-19
Mega breach of 16B passwords raises crypto security fears !Mega breach of 16B passwords raises crypto security fearsimagesnewsmega-breach-of-16b-passwords-raises-crypto-securitc16f3b039a86.jpg A leak of 16 … By Cointelegraph 2025-06-19
Avalanche Game 'Forgotten Playland' Implements NFTs in Biggest Update Yet Forgotten Playland, an Avalanche-powered game on the Beam L1, has integrated in-game item NFTs along with other new features. By Decrypt 2025-06-19
Crypto VC partner loses ‘life savings’ during fake Zoom call !Crypto VC partner loses life savings during fake Zoom callimagesnewscrypto-vc-partner-loses-life-savings-during-fake-z21d55eeba11e.jpg Hypersphere … By Cointelegraph 2025-06-19
Project Eleven raises $6M to defend Bitcoin from quantum attacks !Project Eleven raises 6M to defend Bitcoin from quantum attacksimagesnewsproject-eleven-raises-6m-to-defend-bitcoin-from-qu588fb6064f9e.jpg Quantum … By Cointelegraph 2025-06-19
Nasdaq-listed Lion Group bets big on Hyperliquid with $600M treasury !Nasdaq-listed Lion Group bets big on Hyperliquid with 600M treasuryimagesnewsnasdaq-listed-lion-group-bets-big-on-hyperliquid-wcc175f1931a2.jpg The … By Cointelegraph 2025-06-19
OKX brings DEX aggregator to MetaMask with Consensys partnership !OKX brings DEX aggregator to MetaMask with Consensys partnershipimagesnewsokx-brings-dex-aggregator-to-metamask-with-consensa7e474ad6a51.jpg OKX … By Cointelegraph 2025-06-19
Russia says 70% of crypto miners remain unregistered despite new laws !Russia says 70 of crypto miners remain unregistered despite new lawsimagesnewsrussia-says-70-of-crypto-miners-remain-unregistere87629915012c.jpg … By Cointelegraph 2025-06-19
Canadian Firm Sol Strategies Files With SEC for Nasdaq Debut As a foreign private issuer, the firm will follow Canadian disclosure rules while being exempt from certain U.S. reporting requirements. By Decrypt 2025-06-19
Bitget secures Georgia license as part of Europe expansion !Bitget secures Georgia license as part of Europe expansionimagesnewsbitget-secures-georgia-license-as-part-of-europe-e4a68e576795c.jpg Bitget picks … By Cointelegraph 2025-06-19
Is crypto still taxed in Australia? Major legal update explained !Is crypto still taxed in Australia? Major legal update explainedimagesnewsis-crypto-still-taxed-in-australia-major-legal-upd313be33835f2.jpg … By Cointelegraph 2025-06-19
Why is Bitcoin price stuck? !Why is Bitcoin price stuck?imagesnewswhy-is-bitcoin-price-stuck43aac209dd41.jpg Bitcoin price remains stuck under 112K since May 23, and data … By Cointelegraph 2025-06-19
Bitcoin gets Fed rate pause 'tailwind' as BTC eyes $106K short squeeze !Bitcoin gets Fed rate pause tailwind as BTC eyes 106K short squeezeimagesnewsbitcoin-gets-fed-rate-pause-tailwind-as-btc-eyes-1dfcc7ae22067.jpg … By Cointelegraph 2025-06-19
South Korea to investigate fees of local crypto exchanges !South Korea to investigate fees of local crypto exchangesimagesnewssouth-korea-to-investigate-fees-of-local-crypto-ex08b2bcfab526.jpg South Koreas … By Cointelegraph 2025-06-19
Nobitex source code leaked after $100M hack by pro-Israel group !Nobitex source code leaked after 100M hack by pro-Israel groupimagesnewsnobitex-source-code-leaked-after-100m-hack-by-pro-5f41f311db8c.jpg Hackers … By Cointelegraph 2025-06-19
Binance’s CZ suggests ‘will function’ to distribute crypto in case of death !Binances CZ suggests will function to distribute crypto in case of deathimagesnewsbinances-cz-suggests-will-function-to-distribute-c36fe1c81c552.jpg … By Cointelegraph 2025-06-19
Canada’s Sol Strategies files with SEC to list on the Nasdaq !Canadas Sol Strategies files with SEC to list on the Nasdaqimagesnewscanadas-sol-strategies-files-with-sec-to-list-on-ta337e7f757d2.jpg Sol … By Cointelegraph 2025-06-19
Treasury Secretary Bessent Says Stablecoins Can Bolster US Dollar 'Supremacy’ Bessent framed stablecoins as a strategic asset for U.S. influence, as lawmakers weigh whether politics will stall key legislation again. By Decrypt 2025-06-19
Pacific nation Nauru passes law to establish a crypto regulator !Pacific nation Nauru passes law to establish a crypto regulatorimagesnewspacific-nation-nauru-passes-law-to-establish-a-cryc45b3c03cfea.jpg The … By Cointelegraph 2025-06-19
Bitcoin to Ether shift going unnoticed with ‘bear market PTSD’ — Trader !Bitcoin to Ether shift going unnoticed with bear market PTSD Traderimagesnewsbitcoin-to-ether-shift-going-unnoticed-with-bear-ma8ba27e0a7ef.jpg A … By Cointelegraph 2025-06-19
Ohio House passes bill allowing up to $200 tax-free crypto payments !Ohio House passes bill allowing up to 200 tax-free crypto paymentsimagesnewsohio-house-passes-bill-allowing-up-to-200-tax-freec55cda436dfd.jpg Ohios … By Cointelegraph 2025-06-19
Need ChatGPT’s help? It could be making you dumber !Need ChatGPTs help? It could be making you dumberimagesnewsneed-chatgpts-help-it-could-be-making-you-dumberdb0b6fbdc3bf.jpg MIT research has found … By Cointelegraph 2025-06-19
Bitcoin Scandal Fails to Topple Czech Government in No-Confidence Vote A 45 million Bitcoin donation from a convicted darknet operator set off a political crisis and brought the Czech government to its knees. By Decrypt 2025-06-19
US Bitcoin ETFs hit 8-day inflow streak despite Middle East tensions !US Bitcoin ETFs hit 8-day inflow streak despite Middle East tensionsimagesnewsus-bitcoin-etfs-hit-8-day-inflow-streak-despite-mib88e24ca00e1.jpg The … By Cointelegraph 2025-06-19
1inch Foundation Proposes User Compensation Plan Following October Hack DAO members of 1inch are voting on whether to approve a reimbursement scheme for victims of a supply chain exploit last year. By Decrypt 2025-06-19
Elon Musk’s AI firm xAI faces lawsuit over data center air pollution !Elon Musks AI firm xAI faces lawsuit over data center air pollutionimagesnewselon-musks-ai-firm-xai-faces-lawsuit-over-data-cen75e6c05dcc60.jpg xAI … By Cointelegraph 2025-06-19
Civil Rights Group Gives Elon Musk's xAI 60 Days to Fix Alleged Clean Air Act Violations The NAACP has threatened xAI with a lawsuit over unpermitted gas turbines at Memphis AI data center, citing pollution concerns. By Decrypt 2025-06-19
Iran orders crypto exchange curfew after $100M Nobitex hack !Iran orders crypto exchange curfew after 100M Nobitex hackimagesnewsiran-orders-crypto-exchange-curfew-after-100m-nobi9cf6e727d31c.jpg Chainalysiss … By Cointelegraph 2025-06-19
‘Crypto-native’ asset managers quadruple onchain holdings since January !Crypto-native asset managers quadruple onchain holdings since Januaryimagesnewscrypto-native-asset-managers-quadruple-onchain-hola1bb13c6436a.jpg … By Cointelegraph 2025-06-19
Trump Pushes House to Pass GENIUS Act as Lawmakers Debate Crypto Oversight The President has called on the House to approve the stablecoin bill, despite concerns over conflicts of interest and tech sector influence. By Decrypt 2025-06-19
‘Stablecoin summer’ as Coinbase, Circle surge on stablecoin bill !Stablecoin summer as Coinbase, Circle surge on stablecoin billimagesnewsstablecoin-summer-as-coinbase-circle-surge-on-stab8405187c6767.jpg Crypto … By Cointelegraph 2025-06-19
Czech gov’t resists 4th overthrow attempt amid $45M Bitcoin scandal !Czech govt resists 4th overthrow attempt amid 45M Bitcoin scandalimagesnewsczech-govt-resists-4th-overthrow-attempt-amid-45m-21a3e7a04e59.jpg The … By Cointelegraph 2025-06-19
Trump on GENIUS stablecoin bill: ‘Get it to my desk, ASAP’ !Trump on GENIUS stablecoin bill Get it to my desk, ASAPimagesnewstrump-on-genius-stablecoin-bill-get-it-to-my-desk-3c2e7c6e43c0.jpg US President … By Cointelegraph 2025-06-19
SOL price rally to $200 brewing, but 3 key catalysts must happen first !SOL price rally to 200 brewing, but 3 key catalysts must happen firstimagesnewssol-price-rally-to-200-brewing-but-3-key-catalysts6b29262a2ce4.jpg … By Cointelegraph 2025-06-19
Ohio House Approves Bill Exempting ‘Bitcoin Users’ From Minor Tax Burden The bill, which seeks to grant crypto users and miners certain rights, now moves on to the Ohio State Senate. By Decrypt 2025-06-19
How Far Would You Go to Pump Your Meme Coin? Leland King Fawcette aims to make it across all 50 U.S. states in time to break a recordand pump his Solana meme coin in the process. By Decrypt 2025-06-18
Pavel Durov warns France is experiencing societal collapse !Pavel Durov warns France is experiencing societal collapseimagesnewspavel-durov-warns-france-is-experiencing-societal-b2aeae4f4865.jpg According to … By Cointelegraph 2025-06-18
US DOJ files to seize $225M in crypto tied to pig butchering schemes !US DOJ files to seize 225M in crypto tied to pig butchering schemesimagesnewsus-doj-files-to-seize-225m-in-crypto-tied-to-pig-bfc68bcd31a2b.jpg … By Cointelegraph 2025-06-18
Bitdeer Stock Falls as Bitcoin Miner Aims to Raise $330 Million Singapore-based Bitcoin miner Bitdeer is raising funds, but not to buy up BTC. The firms shares continued falling following the move. By Decrypt 2025-06-18
Crypto Prime Brokerage FalconX in Early Talks for IPO in 2025: Sources FalconX is considering a public listing amid a broader crypto IPO boom, three sources told Decrypt. By Decrypt 2025-06-18
Bitdeer to offer $330M convertible notes to expand operations !Bitdeer to offer 330M convertible notes to expand operationsimagesnewsbitdeer-to-offer-330m-convertible-notes-to-expand-bfc316d5d693.jpg The … By Cointelegraph 2025-06-18
A Lawyer and His Wiener Doge Must Be Separated, Phantom Argues in Meme Coin Lawsuit Phantoms attorneys say you cant create a dog-themed meme coin, and then represent plaintiffs in a lawsuit over it. The litigator-turned-degen in … By Decrypt 2025-06-18
New York authorities freeze $300K linked to crypto scammers !New York authorities freeze 300K linked to crypto scammersimagesnewsnew-york-authorities-freeze-300k-linked-to-crypto-976926fab71b.jpg Officials … By Cointelegraph 2025-06-18
Bitcoin supply squeeze intensifies as ‘ancient’ holders eclipse newly mined BTC !Bitcoin supply squeeze intensifies as ancient holders eclipse newly mined … By Cointelegraph 2025-06-18
Bitcoin Might Be Flat, But Traders Have Their Eyes on This Shiny New Token: Analysis As Bitcoin clings to support levels and geopolitical shocks ripple across risk assets, theres an altcoin keeping things interesting. By Decrypt 2025-06-18
Are Criminals Really Switching From Crypto to Gold for Money Laundering? Police note UK criminals are turning to gold, not crypto, to launder moneybut is it a growing trend or just a glittering myth? By Decrypt 2025-06-18
Justice Dept. Files to Seize Record $225 Million Tied to 'Pig Butchering' Crypto Scams The U.S. Department of Justice has filed to seize over 225 million in USDTthe largest-ever seizure tied to pig butchering crypto scams. By Decrypt 2025-06-18
Ethereum and the battle for yield: What is ETH’s future? !Ethereum and the battle for yield What is ETHs future?imagesnewsethereum-and-the-battle-for-yield-what-is-eths-fute3db3f880f88.jpg Ethereum staking … By Cointelegraph 2025-06-18
Chinese Central Bank pledges global expansion of digital yuan — Report !Chinese Central Bank pledges global expansion of digital yuan Reportimagesnewschinese-central-bank-pledges-global-expansion-of-d9ac59a786c46.jpg … By Cointelegraph 2025-06-18
Bitcoin Shrugs Off Fed Decision to Keep Rates Unchanged The largest cryptocurrency by market value has been trading about 5 under its all-time high set last month. By Decrypt 2025-06-18
Deribit, Crypto.com integrate BlackRock's BUIDL as trading collateral !Deribit, Crypto.com integrate BlackRocks BUIDL as trading collateralimagesnewsderibit-crypto-com-integrate-blackrock-s-buidl-as-ab8e83a0122f.jpg The … By Cointelegraph 2025-06-18
Price predictions 6/18: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, SUI, BCH !Price predictions 618 BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, SUI, BCHimagesnewsprice-predictions-6-18-btc-eth-xrp-bnb-sol-doge-ad82eff77a6a0d.jpg … By Cointelegraph 2025-06-18
Healthcare company onboards Trump crypto adviser, buys $20M BTC !Healthcare company onboards Trump crypto adviser, buys 20M BTCimagesnewshealthcare-company-onboards-trump-crypto-adviser-bf5f0b0c9f090.jpg The … By Cointelegraph 2025-06-18
WILL $HYPE FLIP $SOL? POTENTIAL PUMP.FUN CHAIN, BULL RUN INDICATORS WILL HYPE FLIP SOL? POTENTIAL PUMP.FUN CHAIN, BULL RUN INDICATORS. REKT RADIO LIVE ON DEGENZ. Degenz Live is the only content you need for crypto, … By Decrypt 2025-06-18
ZisK spins off from Polygon with ‘core minds behind Polygon zkEVM’ !ZisK spins off from Polygon with core minds behind Polygon zkEVMimagesnewszisk-spins-off-from-polygon-with-core-minds-behind7a157fcb424c.jpg Polygon … By Cointelegraph 2025-06-18
Coinbase, Circle Stocks Spike Double Digits After Stablecoin Bill Clears Senate Coinbase and Circle are soaring after a key stablecoin bill cleared the Senatebut Fed rate cuts could test their biggest revenue stream. By Decrypt 2025-06-18
Sandeep Nailwal’s Polygon takeover is his chance to ‘go all in’ !Sandeep Nailwals Polygon takeover is his chance to go all inimagesnewssandeep-nailwals-polygon-takeover-is-his-chance-toab842ec26c98.jpg Co-founder … By Cointelegraph 2025-06-18
Food fraud costs $50B yearly — Can blockchain stop it? !Food fraud costs 50B yearly Can blockchain stop it?imagesnewsfood-fraud-costs-50b-yearly-can-blockchain-stop-it54f7ac0987f5.jpg Blockchain has … By Cointelegraph 2025-06-18
Publicly Traded Solana Treasury Firm Is 'Showing What's Next' for Strategy's Bitcoin Model Newly established Solana treasury company DeFi Development Corp. is taking a unique approach in building its digital asset stash. By Decrypt 2025-06-18
'Global Response' to Crypto Regulation Needed as US Advances GENIUS Act: FCA Lord Chris Holmes argued right-size regulation benefits innovation, adding that only grifters and chancers want a regulatory-free environment. By Decrypt 2025-06-18
Bitcoin Falls as Trump Calls Powell ‘Stupid’ Amid Flaring Middle East Tensions The U.S. central bank is expected to hold interest rates steady, but a post-decision press conference could contain linguistic pivots. By Decrypt 2025-06-18
SENATE PASSES GENIUS ACT, FED DECISION TODAY, US-IRAN THREATS GROW SENATE PASSES GENIUS ACT, FED DECISION TODAY, US-IRAN THREATS GROW. FOMO HOUR LIVE ON DEGENZ. Degenz Live is the only content you need for crypto, … By Decrypt 2025-06-18
Washington City Bans Bitcoin ATMs Amid Surge in Crypto Scams Spokanes city council has passed an ordinance targeting crypto kiosks used in a billion-dollar nationwide fraud scheme. By Decrypt 2025-06-18
The empire strikes out: Institutionalists failed to kill the stablecoin bill !The empire strikes out Institutionalists failed to kill the stablecoin … By Cointelegraph 2025-06-18
Bitcoin eyes $105K pre-FOMC as Trump reveals Iran asked for dialogue !Bitcoin eyes 105K pre-FOMC as Trump reveals Iran asked for dialogueimagesnewsbitcoin-eyes-105k-pre-fomc-as-trump-reveals-iran-ad2795a388f84.jpg … By Cointelegraph 2025-06-18
AI Can Help the Crypto Industry, CFTC Commissioner Johnson Says—But Also Boost Fraud Outgoing CFTC Commissioner Kristin Johnson is pushing for fraudsters who use AI to receive harsher penalties. By Decrypt 2025-06-18
How a fake tweet from Paraguay pushed Bitcoin to $110K !How a fake tweet from Paraguay pushed Bitcoin to 110Kimagesnewshow-a-fake-tweet-from-paraguay-pushed-bitcoin-to-1c230fc1c70a5.jpg A fake post from … By Cointelegraph 2025-06-18
Circle’s USDC to become eligible collateral for US futures trading !Circles USDC to become eligible collateral for US futures tradingimagesnewscircles-usdc-to-become-eligible-collateral-for-us-0e54ce018508.jpg USDC, … By Cointelegraph 2025-06-18
Senate passes GENIUS stablecoin bill amid concerns over systemic risk !Senate passes GENIUS stablecoin bill amid concerns over systemic riskimagesnewssenate-passes-genius-stablecoin-bill-amid-concernsd47df2319dbd.jpg … By Cointelegraph 2025-06-18
'Pro-Israel Hacker Group' Drains, Burns $90 Million From Iranian Bitcoin Exchange The Nobitex breach was caused by access control failures, and the stolen funds remain untouched, a security expert told Decrypt. By Decrypt 2025-06-18
Pi Network migration problems: Users report KYC, 2FA and balance errors !Pi Network migration problems Users report KYC, 2FA and balance errorsimagesnewspi-network-migration-problems-users-report-kyc-2fa9b22aed638fd.jpg … By Cointelegraph 2025-06-18
Companies Using Debt to Buy BTC Could ‘Hurt Bitcoin’: Anthony Scaramucci Skybridge Capital founder Anthony Scaramucci isnt buying BTC treasury hype. It will become out of fashion and itll hurt Bitcoin, he said. By Decrypt 2025-06-18
Norwegian crypto firm K33 raising more funds to buy up to 1,000 BTC !Norwegian crypto firm K33 raising more funds to buy up to 1,000 BTCimagesnewsnorwegian-crypto-firm-k33-raising-more-funds-to-buad5c5645b6bd.jpg … By Cointelegraph 2025-06-18
Pudgy Penguins debuts play-to-win game on TON !Pudgy Penguins debuts play-to-win game on TONimagesnewspudgy-penguins-debuts-play-to-win-game-on-ton46c7828eba10.jpg Telegram mini-games reached a … By Cointelegraph 2025-06-18
3iQ launches XRP ETF on Toronto Stock Exchange with Ripple as investor !3iQ launches XRP ETF on Toronto Stock Exchange with Ripple as investorimagesnews3iq-launches-xrp-etf-on-toronto-stock-exchange-wita648b75d4005.jpg … By Cointelegraph 2025-06-18
GENIUS Act can make stablecoins ‘part of US financial infrastructure’ !GENIUS Act can make stablecoins part of US financial infrastructureimagesnewsgenius-act-can-make-stablecoins-part-of-us-financi930abe2a7f06.jpg The … By Cointelegraph 2025-06-18
XRP price consolidates for 200 days: Analysts predict where it’s going next !XRP price consolidates for 200 days Analysts predict where its going … By Cointelegraph 2025-06-18
Crypto Daybook Americas: Bitcoin Holds the Line as Trump Labels Iran Leader ‘Easy Target’ By Francisco Rodrigues All times ET unless indicated otherwise Bitcoin BTC is hovering a smidgen under 105,000 having dropped just 1.4 in the past 24 … By CoinDesk 2025-06-18
Circle dump: Cathie Wood’s Ark sells another $45M as shares tumble !Circle dump Cathie Woods Ark sells another 45M as shares tumbleimagesnewscircle-dump-cathie-woods-ark-sells-another-45m-as-e24fe2fcf2a2.jpg In the … By Cointelegraph 2025-06-18
Chinese Bitcoin ASIC makers to begin US production amid tariff pressure !Chinese Bitcoin ASIC makers to begin US production amid tariff pressureimagesnewschinese-bitcoin-asic-makers-to-begin-us-productionb8e78c4b3c8b.jpg … By Cointelegraph 2025-06-18
Token That’s Literally USELESS Is Crypto’s Latest Meme Cult Cryptos newest memecoin cult is embracing the useless narrative given to joke tokens, making it a play that reached a 100 million valuation in recent … By CoinDesk 2025-06-18
Bitcoin 'Accumulator' Better Fit for Corporates Than Dollar-Cost Averaging Strategy, Research Suggests Corporate adoption of bitcoin BTC is well-known, and most of it involves a classic buy-and-hold strategy, loosely analogous to the dollar-cost … By CoinDesk 2025-06-18
Europe’s first Bitcoin treasury firm buys another $20M BTC, now holds over $170M !Europes first Bitcoin treasury firm buys another 20M BTC, now holds over … By Cointelegraph 2025-06-18
Bitcoin below $100K now ‘less likely’ as BTC price eyes liquidity at $106K !Bitcoin below 100K now less likely as BTC price eyes liquidity at 106Kimagesnewsbitcoin-below-100k-now-less-likely-as-btc-price-eyf9f65509509a.jpg … By Cointelegraph 2025-06-18
Every Fintech Firm Will Run Its Own Blockchain 'in Next Five Years:' Optimism Its only a matter of time until every cryptocurrency exchange and fintech firm is running its own blockchain, according to OP Labs, builder of … By CoinDesk 2025-06-18
Spain's BBVA Is Advising Clients to Invest Up to 7% of Portfolio in BTC, ETH: Reuters Spanish lender BBVA is advising its wealth clients to invest 3-7 of their portfolios in cryptocurrencies, an executive of the Spanish bank said on … By CoinDesk 2025-06-18
The Blockchain Group Adds 182 Bitcoin, Lifts BTC Holdings to Over $170M The Blockchain Group ALTBG, a Paris-listed tech firm that brands itself as Europes first bitcoin BTC treasury company, … By CoinDesk 2025-06-18
China’s JD.com enters stablecoin race as US passes GENIUS Act !Chinas JD.com enters stablecoin race as US passes GENIUS Actimagesnewschinas-jd-com-enters-stablecoin-race-as-us-passes-e5a174826b20.jpg JD.com … By Cointelegraph 2025-06-18
Iranian Crypto Exchange Nobitex Hacked for Nearly $82M by Suspected Israeli Group Iranian crypto exchange Nobitex has been hacked for nearly 82 million by Israel-linked hacking activist group Gonjeshke Darande. The group said in an … By CoinDesk 2025-06-18
Iranian crypto exchange Nobitex reportedly exploited for $73M: ZachXBT !Iranian crypto exchange Nobitex reportedly exploited for 73M ZachXBTimagesnewsiranian-crypto-exchange-nobitex-reportedly-exploit0d78497ee09f.jpg The … By Cointelegraph 2025-06-18
Thailand Exempts Crypto Capital Gains to Boost Global Hub Ambitions Deputy Finance Minister Julapun Amornvivat said Thailand aims to become one of the worlds financial hubs with its crypto tax exemption. By Decrypt 2025-06-18
Ark Invest Dumps Nearly $45M Worth of Circle Shares as U.S. Senate Passes GENIUS Act Cathie Woods Ark Invest sold a combined 300,108 shares of Circle Internet Group CRCL on Tuesday across three of its ETFs, continuing to take profit … By CoinDesk 2025-06-18
Kraken-Backed Ink Foundation to Airdrop INK Token, Starting With Aave-Powered Liquidity Protocol The Ink Foundation, the nonprofit behind layer 2 Ink, is launching its native token INK in an attempt to bootstrap onchain capital markets through a … By CoinDesk 2025-06-18
Agriculture firm AgriFORCE powers 120 crypto miners with natural gas !Agriculture firm AgriFORCE powers 120 crypto miners with natural gasimagesnewsagriculture-firm-agriforce-powers-120-crypto-minera2a8488773c0.jpg … By Cointelegraph 2025-06-18
Bitcoin, crypto dip as Trump says Iran’s leader an ‘easy target’ !Bitcoin, crypto dip as Trump says Irans leader an easy targetimagesnewsbitcoin-crypto-dip-as-trump-says-irans-leader-an-ef3c9bba0342e.jpg The crypto … By Cointelegraph 2025-06-18
SHIB Long-Short Ratio Slides as Over $1.8M in Bullish Bets Liquidated A key indicator is flashing red for shiba inu SHIB as the recent price drop to two-month lows has shaken out leveraged bullish bets. The indicator in … By CoinDesk 2025-06-18
Washington’s second-biggest city, Spokane, bans crypto ATMs !Washingtons second-biggest city, Spokane, bans crypto ATMsimagesnewswashingtons-second-biggest-city-spokane-bans-crypte41d5aeacc32.jpg Spokane City … By Cointelegraph 2025-06-18
Bitcoin Traders’ Are Looking at a Key Data Point in Fed Meeting and Its Not Interest Rate Decision The Federal Reserves Fed Open Market Committee, comprising 12 officials, is scheduled to announce its decision on interest rates at 1800 UTC on … By CoinDesk 2025-06-18
Gemini Files Complaint Against CFTC, Alleges 7-Year 'Lawfare' Campaign Gemini flagged a whistleblower tied to fraud who may still receive a 1.5 million award, despite an arbitrator ruling he lied to regulators. By Decrypt 2025-06-18
Archetyp dark web market shut down, but ecosystem adapts: TRM Labs !Archetyp dark web market shut down, but ecosystem adapts TRM Labsimagesnewsarchetyp-dark-web-market-shut-down-but-ecosystem-afdfed5dd8659.jpg The … By Cointelegraph 2025-06-18
Dogecoin Zips Down 7% Amid Low Risk-On Sentiment Dogecoin tumbled as much as 7.5 in 24 hours, sliding from 0.176 to 0.164 as markets continue to react to rising geopolitical conflict in the Middle … By CoinDesk 2025-06-18
XRP, ADA Lead Crypto Majors Slide, While Bitcoin Watchers Target Return to Highs in Q3 Crypto markets slipped across the board Wednesday, with altcoins leading the decline and Bitcoin continuing to trade in a tight band just above … By CoinDesk 2025-06-18
XRP Drops 5% as High-Volume Selling Pressure Dominates Market XRP fell 4.5 over the past 24 hours, dropping from 2.254 to 2.164 as sellers overwhelmed buyers and forced a breakdown below key support levels. The … By CoinDesk 2025-06-18
Meta is Attempting to Poach OpenAI Staff With $100M Signing Bonuses: Sam Altman OpenAI CEO Sam Altman said Tuesday Facebook parent Meta is attempting to woo his employees with limited success. By Decrypt 2025-06-18
Bitcoin and HYPE could get $844M total windfall from 4 public US firms !Bitcoin and HYPE could get 844M total windfall from 4 public US firmsimagesnewsbitcoin-and-hype-could-get-844m-total-windfall-froaf23a64a0607.jpg … By Cointelegraph 2025-06-18
Spanish bank BBVA suggests clients make 7% crypto allocation !Spanish bank BBVA suggests clients make 7 crypto allocationimagesnewsspanish-bank-bbva-suggests-clients-make-7-crypto-abb8928a36597.jpg BBVA is … By Cointelegraph 2025-06-18
Bitcoin downside risk lingers, upside hinges on holding above $102K !Bitcoin downside risk lingers, upside hinges on holding above 102Kimagesnewsbitcoin-downside-risk-lingers-upside-hinges-on-hol696fb1da9509.jpg … By Cointelegraph 2025-06-18
China’s JD Eyes Global Stablecoin Licenses to Slash Payment Costs Chinese e-commerce giant JD.com says it could cut cross-border settlement costs as it plans to acquire stablecoin licenses By Decrypt 2025-06-18
Meta Pool hit with $27M exploit, but attacker flees with only $132K !Meta Pool hit with 27M exploit, but attacker flees with only 132Kimagesnewsmeta-pool-hit-with-27m-exploit-but-attacker-flees-ea85114a425d.jpg Meta … By Cointelegraph 2025-06-18
OpenAI Lands Pentagon Deal—Musk’s xAI Left Watching From Sidelines A new 200 million contract with the Department of Defense puts OpenAI ahead in the race to bring AI to government. By Decrypt 2025-06-18
Asia Morning Briefing: GENIUS Act Positions ETH at the Center of Tokenized Finance, Says Wall Street Veteran Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-06-18
JPMorgan, SEC meet to discuss capital markets moving onchain !JPMorgan, SEC meet to discuss capital markets moving onchainimagesnewsjpmorgan-sec-meet-to-discuss-capital-markets-movin8b533a790304.jpg Three … By Cointelegraph 2025-06-18
How to Get Your Chatbot to Talk Dirty Users seeking steamy romance from their AI companions are getting yoga guides instead. Heres how to stop your chatbot from pivoting from passion to … By Decrypt 2025-06-17
Is Semler Scientific Flashing a Warning Sign for Bitcoin Treasury Firms? The company was valued at a razor-thin premium compared to its Bitcoin holdings, as of Tuesday. By Decrypt 2025-06-17
Tron Inc. Deal Gives Justin Sun’s Father Control of Public Firm Via $100M Token Deal A Securities and Exchange Commission SEC filing posted Mondayhttpswww.sec.govArchivesedgardata1956744000164117225015300form8-k.htm night outlines the … By CoinDesk 2025-06-17
Bitcoin Miners Face More Trouble as Transaction Fee Share Hits 3-Year Low Bitcoin transaction fee rewards have dropped to their lowest level since 2022, making the already tough BTC mining industry even tougher. By Decrypt 2025-06-17
Elon Musk’s xAI Seeks $4.3 Billion in Fresh Funding: Bloomberg xAI, Elon Musks rising startup, is aiming to secure billions more in funding to fuel its AI ambitions, per a report. By Decrypt 2025-06-17
JP Morgan's JPMD 'Stablecoin' Is Actually a Deposit Token on Base The token will be available for use by select Coinbase institutional clients, before later becoming available to more traders, pending regulators … By Decrypt 2025-06-17
25% Bitcoin price rally set to follow today’s correction if history repeats !25 Bitcoin price rally set to follow todays correction if history … By Cointelegraph 2025-06-17
US Senate passes GENIUS stablecoin bill in 68-30 vote !US Senate passes GENIUS stablecoin bill in 68-30 voteimagesnewsus-senate-passes-genius-stablecoin-bill-in-68-30-v27c6d87c53fa.jpg The bill passed … By Cointelegraph 2025-06-17
U.S. Senate Passes GENIUS Act to Regulate Stablecoins, Marking Crypto Industry Win The overwhelming bipartisan passage of the U.S. Senates stablecoin bill, with a 68-30 final vote that saw a huge surge of Democrats joining their … By CoinDesk 2025-06-17
Senate Passes Landmark Stablecoin Bill in Major Boon for Crypto Industry Tuesdays vote marks the crypto industrys greatest legislative achievement yet. But hurdles remain before the stablecoin bill becomes law. By Decrypt 2025-06-17
SEC opens Franklin Templeton XRP, SOL ETF proposals to comments !SEC opens Franklin Templeton XRP, SOL ETF proposals to commentsimagesnewssec-opens-franklin-templeton-xrp-sol-etf-proposals706b45df17d8.jpg The … By Cointelegraph 2025-06-17
Next-Gen Xbox Preview: Everything You Need to Know About the Console and Crypto Plans UPDATE Microsoft just confirmed whos providing the tech behind its next-gen Xbox consoles. Heres what you need to know. By Decrypt 2025-06-17
Ether price stable near $2.4K as crypto investors bet on long-term growth !Ether price stable near 2.4K as crypto investors bet on long-term growthimagesnewsether-price-stable-near-2-4k-as-crypto-investors-b591a3ef2765c.jpg … By Cointelegraph 2025-06-17
Coinbase Eyes SEC Green Light for Trading of Tokenized Stocks: Reuters Coinbase wants to offer stocks that trade on blockchains, according to an interview with the exchanges legal chief. By Decrypt 2025-06-17
Bitcoin Financial Services Firm Fold Set to Unload $250 Million on BTC Buys The publicly traded Bitcoin financial services firm plans to issue and sell shares of its stock, largely to add more Bitcoin to its corporate … By Decrypt 2025-06-17
Kraken's Ethereum Layer-2 Ink Network Is Launching a Token The Ink Foundation will debut a native token for Krakens Ethereum layer-2 network. Heres what we know so far. By Decrypt 2025-06-17
JPMorgan Introduces USD Deposit Token on Coinbase’s Base Blockchain U.S. banking giant JPMorgan has announced the pilot of a permissioned USD deposit token called JPMD on Base, the layer 2 Ethereum network built by … By CoinDesk 2025-06-17
JPMorgan pushes JPMD pilot on Base, says deposit tokens beat stablecoins !JPMorgan pushes JPMD pilot on Base, says deposit tokens beat stablecoinsimagesnewsjpmorgan-pushes-jpmd-pilot-on-base-says-deposit-to307a29dfbc09.jpg … By Cointelegraph 2025-06-17
Coinbase Seeks SEC Approval to Offer Tokenized Stock Trading Coinbase is seeking approval from the U.S. Securities and Exchange Commission SEC to launch tokenized stock trading, a move that could expand its … By CoinDesk 2025-06-17
GENIUS Act could strengthen dollar power, write ‘rulebook’ for global financial system !GENIUS Act could strengthen dollar power, write rulebook for global financial … By Cointelegraph 2025-06-17
Bitcoin, Altcoins Plunge as Trump's Threat to Assassinate Iran Leader Escalates Middle East Tensions Bitcoin, Ethereum, and other coins are down after President Trump threatens to have Irans leader assassinated. By Decrypt 2025-06-17
Regulatory uncertainty looms as CFTC struggles with vacancies !Regulatory uncertainty looms as CFTC struggles with vacanciesimagesnewsregulatory-uncertainty-looms-as-cftc-struggles-wit210ec5eec874.jpg New … By Cointelegraph 2025-06-17
Can Tether's Dominance Survive the U.S. Stablecoin Bill? Tethers USDT is the worlds leading stablecoin. Its digital emulation of the U.S. dollar 155 billion of them at last count is unmatched. But as … By CoinDesk 2025-06-17
JP Morgan Exec Wary of 'Overcrowding' Stablecoin Market as Bank Registers JPMD Trademark JP Morgan warns of an overcrowding stablecoin market while major banks await regulatory clarity. The GENIUS Act faces a crucial Senate vote today. By Decrypt 2025-06-17
Why Blockchain Valuation Models Are Still Up for Debate Valuing blockchain networks today feels like dj vu for anyone who lived through the early internet era. In the 1990s, analysts, investors, and … By CoinDesk 2025-06-17
Shiba Inu Slides to Two-Month Low as Trump Threatens Khamenei, Demands Unconditional Surrender Shiba inu SHIB, the worlds second-largest meme token by market value, faced selling pressure alongside losses in the broader crypto market and U.S. … By CoinDesk 2025-06-17
Cycles eyes sustainable crypto credit after 2022 liquidity crisis !Cycles eyes sustainable crypto credit after 2022 liquidity crisisimagesnewscycles-eyes-sustainable-crypto-credit-after-2022-l00870db9edba.jpg The … By Cointelegraph 2025-06-17
Bitcoin Heads Lower as Trump Threatens to Assassinate Iran’s Supreme Leader The U.S. may soon go to war against Iran, and crypto markets arent liking the prospect. Bitcoin BTC is down 3.8 in the last 24 hours, trading under … By CoinDesk 2025-06-17
Meme Coin Massacre: Buying Opportunity or a Warning to Exit? PEPE drops 12, SPX6900 dives 11, and Fartcoin falls 9 amid geopolitical shocks and whale exits. Is the meme coin market facing a hard reset? By Decrypt 2025-06-17
Can the Real Cypherpunks Please Stand Up? Am I the only one feeling a growing sense of cognitive dissonancehttpsx.comAcynstatus1934018536571371719 in crypto right now? The crypto industry has … By CoinDesk 2025-06-17
AgriFORCE Launches Gas-Powered Bitcoin Mining Site in Alberta, Plans Expansion to 1 EH/s AgriFORCE Growing Systems AGRI, a small agricultural firm that recently adopted bitcoin mining, has … By CoinDesk 2025-06-17
Coinbase is seeking SEC approval for ‘tokenized equities’ — Report !Coinbase is seeking SEC approval for tokenized equities Reportimagesnewscoinbase-is-seeking-sec-approval-for-tokenized-equ6beba6c79ceb.jpg If … By Cointelegraph 2025-06-17
TRUMP'S CRYPTO RISK, THE CRCL TRADE, MARKET VOLATILITY TRUMPS CRYPTO RISK, THE CRCL TRADE, MARKET VOLATILITY UNDER EXPOSED LIVE ON DEGENZ. Degenz Live is the only content you need for crypto, macro, … By Decrypt 2025-06-17
Institutional Investors Ready to Buy Crypto ETPs 'In a Matter of Weeks' as UK FCA Approval Looms: WisdomTree Institutional investors representing retail clients are waiting for the UK regulator to fire the starting gun, said the digital asset manager. By Decrypt 2025-06-17
Bitcoin price stabilizes and rallies amid regional conflicts, data shows !Bitcoin price stabilizes and rallies amid regional conflicts, data showsimagesnewsbitcoin-price-stabilizes-and-rallies-amid-regional9b498bad4c89.jpg … By Cointelegraph 2025-06-17
NEAR Plunges 8% as Middle East Tensions Rattle Crypto Markets Escalating tension in the Middle East between Iran and Israel continues to ripple through the cryptocurrency market, prompting significant downside … By CoinDesk 2025-06-17
This Crypto Gaming PC Will Self-Destruct on Command Ethereum gaming protocol Base has acquired PC rig maker Andromeda Insights, revealing a crypto-ready desktop with a head-turning feature. By Decrypt 2025-06-17
What Does Ethereum’s Staking Record Signal for the Asset? Staking dynamics affect Ethereums circulating supply. By Decrypt 2025-06-17
BNB Price Falls Below Technical Support as Market Awaits FOMC Clues Amid Geopolitical Tension BNB, the native token of BNB Chain, fell 1.7 over the past 24-hour period, rattled by growing market unease as the conflict between Israel and Iran … By CoinDesk 2025-06-17
Solana Foundation, Bitget Wallet join Ondo Finance’s ‘market alliance’ !Solana Foundation, Bitget Wallet join Ondo Finances market allianceimagesnewssolana-foundation-bitget-wallet-join-ondo-finances21db51a4afa2.jpg … By Cointelegraph 2025-06-17
HyperLiquid Trader Turns $10M Profit Into $2.5M Loss as Bitcoin Falls A trader on decentralized derivatives exchange HyperLiquid has turned an unrealized 10 million profit into a 2.5 million loss, seemingly caught by … By CoinDesk 2025-06-17
Filecoin Plunges 6% On Heavy Volume, Breaks Technical Support at $2.52 Level Filecoin FIL underwent a notable 5.8 decline over the 24-hour period, dropping from a high of 2.569 to a low of 2.406, according to CoinDesk … By CoinDesk 2025-06-17
ADA Slides to $0.615 as Sell-Off Deepens and Support Faces Pressure Cardanos ADA ADA token traded at 0.6154 Monday afternoon, extending its decline to 5.35 over the past 24 hours. The token dropped steadily through … By CoinDesk 2025-06-17
AVAX Loses 5.8% After Rejection at Critical $20 Short-Term Resistance After reaching a high of 19.99, Avalanches token AVAX was sharply rejected at the 20 psychological barrier, triggering accelerated selling that drove … By CoinDesk 2025-06-17
Bitcoin threatens $104K 'rug pull' as trader says major move yet to come !Bitcoin threatens 104K rug pull as trader says major move yet to comeimagesnewsbitcoin-threatens-104k-rug-pull-as-trader-says-maj52c50c72b465.jpg … By Cointelegraph 2025-06-17
TRUMP SPOOKS MARKETS, JP MORGAN STABLECOIN COMING, TRON TO IPO TRUMP SPOOKS MARKETS, JP MORGAN STABLECOIN COMING, TRON TO IPO - FOMO HOUR LIVE ON DEGENZ. Degenz Live is the only content you need for crypto, … By Decrypt 2025-06-17
The secret map whales use to liquidate you (learn how to read it) !The secret map whales use to liquidate you learn how to read itimagesnewsthe-secret-map-whales-use-to-liquidate-you-learn-h087afada7614.jpg Bitcoin … By Cointelegraph 2025-06-17
How Michael Saylor’s Strategy became the largest Bitcoin holder !How Michael Saylors Strategy became the largest Bitcoin holderimagesnewshow-michael-saylors-strategy-became-the-largest-bi19dfe6cfd09d.jpg Michael … By Cointelegraph 2025-06-17
Glassnode on ETH Whales: ‘This Scale of Buying Hasn’t Been Seen Since 2017’ Ether ETH ETH traded at 2,555.77 on Tuesday, down 3.7 over the past 24 hours after a sharp rejection near the 2,673 level triggered a wave of … By CoinDesk 2025-06-17
ATOM Plunges 6% as North Korea Links Trigger Security Concerns The discovery of a North Korea-linked developer who contributed to Cosmos code between 2022-2024 has triggered enhanced security measures, while … By CoinDesk 2025-06-17
The crypto fund domicile decision: EU or the UK? !The crypto fund domicile decision EU or the UK?imagesnewsthe-crypto-fund-domicile-decision-eu-or-the-uk78559f0a4bee.jpg As the EUs MiCA regulation … By Cointelegraph 2025-06-17
SOL Drops Below $150 After Sell-Off Despite Growing Institutional Adoption Narrative Solanas SOL SOL fell 4.24 over the past 24 hours to trade at 149.46, retreating from a high of 158.54 following a sharp overnight sell-off. Trading … By CoinDesk 2025-06-17
Ubyx raises $10M to standardize stablecoin redemption and drive adoption !Ubyx raises 10M to standardize stablecoin redemption and drive adoptionimagesnewsubyx-raises-10m-to-standardize-stablecoin-redemptifada2fb8f2d5.jpg … By Cointelegraph 2025-06-17
Flare Network bridges XRP to DeFi to unlock dormant liquidity !Flare Network bridges XRP to DeFi to unlock dormant liquidityimagesnewsflare-network-bridges-xrp-to-defi-to-unlock-dormancac86504eb6a.jpg Flare … By Cointelegraph 2025-06-17
XRP Gets Another DeFi Boost Through Flare’s FAssets and FXRP, Messari Says Flare Network is helping push XRP deeper into decentralized finance DeFi with FXRP a fully collateralized, non-custodial representation of XRP on … By CoinDesk 2025-06-17
Staked Ethereum hits 35M ETH high as liquid supply declines !Staked Ethereum hits 35M ETH high as liquid supply declinesimagesnewsstaked-ethereum-hits-35m-eth-high-as-liquid-supply50e1e72fc47c.jpg Over 28 of … By Cointelegraph 2025-06-17
This crypto trader just lost $100M, but he’s still not done !This crypto trader just lost 100M, but hes still not doneimagesnewsthis-crypto-trader-just-lost-100m-but-hes-still-nod7ca201aa1c5.jpg James Wynns … By Cointelegraph 2025-06-17
Latin America Oil, Gas Deal Worth $75M Gets Tokenized as RWA Momentum Builds The landmark acquisition of a working oil and gas facility in Latin America worth 75 million was completed using stablecoins and tokenized debt and … By CoinDesk 2025-06-17
Meta Pool, a Liquid Staking Protocol, Suffers $27M Exploit Multi-chain liquid staking protocol Meta Pool suffered a smart contract exploit on Tuesday, resulting in the loss of 27 million. Blockchain security … By CoinDesk 2025-06-17
Bitcoin Rewards Firm Fold Secures $250M Facitlity to Expand BTC Holdings Fold FLD, a publicly traded bitcoin financial services company, has secured an equity purchase facility worth up to 250 million to grow its bitcoin … By CoinDesk 2025-06-17
Will Tron’s Wall Street hopes implode with TRX as collateral? !Will Trons Wall Street hopes implode with TRX as collateral?imagesnewswill-trons-wall-street-hopes-implode-with-trx-as-ce5208852444a.jpg Trons … By Cointelegraph 2025-06-17
Watch these Bitcoin price levels ahead of Fed Chair Powell's speech !Watch these Bitcoin price levels ahead of Fed Chair Powells speechimagesnewswatch-these-bitcoin-price-levels-ahead-of-fed-chai265cd0d7e8b7.jpg … By Cointelegraph 2025-06-17
CoinDesk 20 Performance Update: Index Drops 4.1% as All Assets Trade Lower CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-06-17
RWA backing: How do issuers ensure 1:1 peg with tokenized assets? !RWA backing How do issuers ensure 11 peg with tokenized assets?imagesnewsrwa-backing-how-do-issuers-ensure-1-1-peg-with-tokc835823532fa.jpg The … By Cointelegraph 2025-06-17
Thailand approves five-year crypto tax exemption !Thailand approves five-year crypto tax exemptionimagesnewsthailand-approves-five-year-crypto-tax-exemptionad6f3df20a96.jpg Thailands crypto income … By Cointelegraph 2025-06-17
EigenLayer Gets $70M From a16z to Launch Off-Chain Verifiability Platform EigenLayer has secured 70 million for a platform that enables blockchain-grade verification for off-chain apps in AI, finance, and beyond. By Decrypt 2025-06-17
Ethereum and Solana Meme Coins PEPE, FLOKI, WIF Lead Losses as Market Dips Meme coins Pepe, Floki Inu and Dogwifhat have led losses as the crypto market experiences a 3.5 pullback Tuesday morning. By Decrypt 2025-06-17
a16z Bets Big on EigenLayer Again With $70M Token Buy to Back ‘EigenCloud’ Launch Venture capital firm Andreessen Horowitz a16z has invested an additional 70 million in EigenLayer, Ethereums largest restaking protocol, to support … By CoinDesk 2025-06-17
CoinDesk Indices, Sentora Unveil Stablecoin Overnight Rates to Mirror Money Market Tools CoinDesk Indices and decentralized financehttpswww.coindesk.comlearnwhat-is-defi DeFi specialist … By CoinDesk 2025-06-17
Gemini accuses CFTC enforcers of ‘trophy-hunting lawfare’ in 2022 !Gemini accuses CFTC enforcers of trophy-hunting lawfare in 2022imagesnewsgemini-accuses-cftc-enforcers-of-trophy-hunting-la3cd550e63044.jpg Gemini … By Cointelegraph 2025-06-17
Stablecoin Clearing Startup Ubyx Raises $10M Round Backed by Galaxy, Coinbase, Others Ubyx, a startup founded by ex-Citigroup executive Tony McLaughlin, has raised 10 million to build a global stablecoin clearing system aiming to … By CoinDesk 2025-06-17
From OpenAI to blockchain: Joey Bertschler builds crypto wage access platform !From OpenAI to blockchain Joey Bertschler builds crypto wage access … By Cointelegraph 2025-06-17
Malaysia launches Digital Asset Hub to test stablecoin, programmable money !Malaysia launches Digital Asset Hub to test stablecoin, programmable … By Cointelegraph 2025-06-17
Why is Solana (SOL) price down today? !Why is Solana SOL price down today?imagesnewswhy-is-solana-sol-price-down-today3c9756cdbbe6.jpg Pump.fun ban and increasing geopolitical risks in … By Cointelegraph 2025-06-17
How to mine Bitcoin at home in 2025 !How to mine Bitcoin at home in 2025imagesnewshow-to-mine-bitcoin-at-home-in-20259cd2e2eb4618.jpg Discover how to mine Bitcoin at home in 2025 using … By Cointelegraph 2025-06-17
Bitcoin price top metric with 10-year record stays 'neutral' at $112K !Bitcoin price top metric with 10-year record stays neutral at 112Kimagesnewsbitcoin-price-top-metric-with-10-year-record-staysc673f813c037.jpg … By Cointelegraph 2025-06-17
Bitcoin Cash-Bitcoin Ratio Smashes Triangle Pattern; HYPE Rally May Be Over This is a daily technical analysis by CoinDesk analyst and Chartered Market Technician Omkar Godbole. Bitcoin cash BCH, the best performing top 100 … By CoinDesk 2025-06-17
How one Bitcoin user accidentally paid $60K in fees and how you can avoid it !How one Bitcoin user accidentally paid 60K in fees and how you can avoid … By Cointelegraph 2025-06-17
Bitcoin Price Holds Steady Amid Iran Conflict Fears Analysts told Decrypt they expect Bitcoin to remain stable until there is more clarity about the U.S. response to Middle East tensions. By Decrypt 2025-06-17
Polyhedra Blames Liquidity Attacks for Sudden 80% Price Drop in ZKJ, Promises Buyback Polyhedra, a crypto protocol whose company reached unicorn … By CoinDesk 2025-06-17
CRYPTO REBOUNDS AFTER MIDDLE EAST CONFLICT, HYPE KEEPS GOING HIGHER! CRYPTO REBOUNDS AFTER MIDDLE EAST CONFLICT, HYPE KEEPS GOING HIGHER! - FOMO HOUR LIVE ON DEGENZ. Degenz Live is the only content you need for crypto, … By Decrypt 2025-06-17
Crypto Daybook Americas: Institutions Pile In Amid 'High Conviction' That Prices Will Grind Higher By Omkar Godbole All times ET unless indicated otherwise Since Friday, cryptocurrencies, especially bitcoin BTC, have demonstrated resilience in the … By CoinDesk 2025-06-17
XRP Jumps as Bulls Push Through Key Resistance Levels XRP XRP climbed 3.6 over the last 24 hours, peaking at 2.33 before settling near 2.25, as buyers capitalized on market volatility. The token overcame … By CoinDesk 2025-06-17
Bitcoin ETFs add $412M, extend 6-day inflow streak amid Israel-Iran conflict !Bitcoin ETFs add 412M, extend 6-day inflow streak amid Israel-Iran … By Cointelegraph 2025-06-17
EU Risks Becoming Crypto ‘Flyover Zone’ Between US, Asia: Franklin Templeton The United States crypto-friendly approach has given the EU a shot in the arm as it mulls an update to 2023s MiCA regulations. By Decrypt 2025-06-17
Analyst: Prepare for a 530% XRP price breakout to $14 if this happens !Analyst Prepare for a 530 XRP price breakout to 14 if this happensimagesnewsanalyst-prepare-for-a-530-xrp-price-breakout-to-14eade64427c7c.jpg XRP … By Cointelegraph 2025-06-17
Polymarket Odds on U.S. Military Action Against Iran Slide as Trump Team Proposes Tehran Talks Traders on decentralized betting platform Polymarket have scaled back expectations for U.S. military action against Iran amid reports that President … By CoinDesk 2025-06-17
Cathie Wood’s ARK dumps first Circle shares batch for $52M !Cathie Woods ARK dumps first Circle shares batch for 52Mimagesnewscathie-woods-ark-dumps-first-circle-shares-batch-f25a0153718e6.jpg Circle is one … By Cointelegraph 2025-06-17
Genius Group Bitcoin treasury grows 52% as 1,000 BTC goal reaffirmed !Genius Group Bitcoin treasury grows 52 as 1,000 BTC goal reaffirmedimagesnewsgenius-group-bitcoin-treasury-grows-52-as-1000-btc68d97e36ff01.jpg The … By Cointelegraph 2025-06-17
ARK Invest Offloads Over $50M in Circle Shares as Stock Extends Rally Cathie Woods ARK Invest trimmed its holdings on its sizable Circle CRCL position Monday, selling 51.8 million worth of shares, as the stablecoin … By CoinDesk 2025-06-17
Alex Mashinsky won’t get a piece of Celsius’ bankruptcy pie, judge says !Alex Mashinsky wont get a piece of Celsius bankruptcy pie, judge saysimagesnewsalex-mashinsky-wont-get-a-piece-of-celsius-bankrup608c26548df4.jpg … By Cointelegraph 2025-06-17
XRP Hits 12-Year Milestone With Over 2,700 Whales, Holding Over 1M XRP, Onchain Data Show The number of whale wallets holding large amounts of XRP XRP has increased to a record high in a sign of confidence in the cryptocurrencys price … By CoinDesk 2025-06-17
SBF Portrayed in Sold-Out Prison Musical With Luigi Mangione, 'Diddy' as Inmates SBF joins Luigi Mangione and Sean Diddy Combs in a provocative dark comedy exploring Americas fascination with fallen icons. By Decrypt 2025-06-17
Deribit Sees Strong Demand From Institutions, Volume on Its Block RFQ Tool Reaches $23B in Four Months The institutionalization of cryptocurrencies is accelerating rapidly. Crypto derivatives exchange Deribits on-demand liquidity tool, the Deribit … By CoinDesk 2025-06-17
Pump.fun and its founder hit in X account suspension blitz !Pump.fun and its founder hit in X account suspension blitzimagesnewspump-fun-and-its-founder-hit-in-x-account-suspensiacf5d111c535.jpg X has … By Cointelegraph 2025-06-17
Optimism targets decentralization with ‘season 8’ governance revamp !Optimism targets decentralization with season 8 governance revampimagesnewsoptimism-targets-decentralization-with-season-8-go5df89fe9df8a.jpg A new … By Cointelegraph 2025-06-17
Arthur Hayes says to trade new stablecoin IPOs like a ‘hot potato’ !Arthur Hayes says to trade new stablecoin IPOs like a hot potatoimagesnewsarthur-hayes-says-to-trade-new-stablecoin-ipos-likcf65af96a8a8.jpg The … By Cointelegraph 2025-06-17
Eric Trump Denies Involvement in Tron Nasdaq Deal Despite Board Role Eric Trump says he has no public involvement in Trons reverse merger effort, despite sitting on the board of a bank brokering the deal. By Decrypt 2025-06-17
Pump.fun and Other Memecoin Accounts Suspended From X in Apparent Crackdown Social media giant X suspended Pump.funs official account and co-founder Alon Cohens personal handle on June 16, alongside other memecoin-related … By CoinDesk 2025-06-17
9GAG founder’s MemeStrategy gains 29% after first Solana buy !9GAG founders MemeStrategy gains 29 after first Solana buyimagesnews9gag-founders-memestrategy-gains-29-after-first-so0caaaacc02f8.jpg Hong Kong … By Cointelegraph 2025-06-17
Dogecoin Shows ‘Higher-Highs’ Price Action in Short-Term Relief for Bulls Dogecoin DOGE climbed 4.29 over the past 24 hours, rising from 0.173 to 0.180, as broad market liquidations swept through the crypto market during … By CoinDesk 2025-06-17
XRP Leads Crypto Majors Gains as Bitcoin is Continuously Tested by Israel-Iran Tensions A fog of uncertainty continues to hang over global markets as crypto assets trade sideways, ahead of this weeks U.S. Federal Reserve meeting. While … By CoinDesk 2025-06-17
Solana-Based Pump.fun Among List of Crypto Trading Platforms Suspended from X Accounts linked to Pump.fun, GMGN and other Solana-based projects have been taken down without warning, triggering speculation as to why. By Decrypt 2025-06-17
Polymarket Odds on US Strike Against Iran Spike, Then Fall The conflict has sparked interest among punters, even as the odds of a U.S. strike against Iran on Polymarket fall. By Decrypt 2025-06-17
Paradigm urges jury clarity in Roman Storm’s Tornado Cash case !Paradigm urges jury clarity in Roman Storms Tornado Cash caseimagesnewsparadigm-urges-jury-clarity-in-roman-storms-tornad99480cd21169.jpg Paradigms … By Cointelegraph 2025-06-17
Bitcoin production costs up 9% on higher hashrate, energy prices !Bitcoin production costs up 9 on higher hashrate, energy pricesimagesnewsbitcoin-production-costs-up-9-on-higher-hashrate-ea01842719203.jpg The … By Cointelegraph 2025-06-17
Asia Morning Briefing: Tron's Public Listing Might be Investors' 'Visa' Moment for Stablecoins Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-06-17
Bitcoin dips amid reports Trump has called advisers to situation room !Bitcoin dips amid reports Trump has called advisers to situation roomimagesnewsbitcoin-dips-amid-reports-trump-has-called-adviserb21702bd1527.jpg … By Cointelegraph 2025-06-17
China’s $9 AI Video Tool Kling 2.1 Adds Audio—Can It Beat Google’s $250 Veo 3? Kuaishou has rolled out synchronized sound effects for its video generator in a bid to challenge Googles Veo3. But is it better? By Decrypt 2025-06-17
Avalanche Launches Free Gaming 'Battle Pass' With AVAX and NFT Rewards The free Avalanche Battle Pass NFT, which can be minted at Magic Eden, provides token rewards to crypto gamers. By Decrypt 2025-06-17
JPMorgan files ‘JPMD’ trademark for crypto payment services !JPMorgan files JPMD trademark for crypto payment servicesimagesnewsjpmorgan-files-jpmd-trademark-for-crypto-payment-s422834f313d1.jpg JPMorgan has … By Cointelegraph 2025-06-16
Cantor Sees 75% Upside in Solana-Focused Stocks With New Analyst Coverage Cantor analysts think Solana-linked stocks could outperform by offering faster crypto exposure and income through staking. By Decrypt 2025-06-16
Fairmint calls for blockchain framework for private markets in SEC proposal !Fairmint calls for blockchain framework for private markets in SEC … By Cointelegraph 2025-06-16
Polyhedra cites liquidity attacks, Wintermute deposits behind ZKJ price drop !Polyhedra cites liquidity attacks, Wintermute deposits behind ZKJ price … By Cointelegraph 2025-06-16
JP Morgan Files Trademark for JPMD: Is It a Stablecoin? The U.S. investment bank has submitted a regulatory filing has submitted a regulatory filing to trademark JPMDa mysterious project proposal that some … By Decrypt 2025-06-16
Crypto Is Now Trump's Second-Most Lucrative Source of Income The president made more money off crypto than most income streams in 2024before he re-assumed the White House and made billions more off the sector. By Decrypt 2025-06-16
BTC Tops $108K on JPMorgan Crypto Filing, XRP Rallies on ETF News Crypto markets pushed higher on Monday as traders have shifted focus from geopolitical anxieties to crypto-related institutional developments ahead … By CoinDesk 2025-06-16
'AI Godfather' Warns Superintelligent Machines Could Kill Off Humans With Biowarfare Geoffrey Hinton warned that AI may surpass humans in all domainsand could eliminate us via autonomous weapons, cyberattacks, and biowarfare. By Decrypt 2025-06-16
Coinbase Faces Backlash Over 'Tone-Deaf' Sponsorship of US Army Parade Some crypto users are upset at Coinbase for sponsoring Trumps U.S. Army parade, due to the firms past statements and a belief that Bitcoin is … By Decrypt 2025-06-16
Coinbase slammed for backing US Army parade !Coinbase slammed for backing US Army paradeimagesnewscoinbase-slammed-for-backing-us-army-parade928723d6dee7.jpg US President Donald Trump promoted … By Cointelegraph 2025-06-16
Eric Trump is 'biggest fan' of Justin Sun, but denies involvement in Tron’s public venture !Eric Trump is biggest fan of Justin Sun, but denies involvement in Trons public … By Cointelegraph 2025-06-16
What Happens to USDC Reserves If Circle Goes Bankrupt? Circles stock is soaring right nowbut what happens to the assets backing its USDC stablecoin if the public firm goes bust? By Decrypt 2025-06-16
JPMorgan Files Trademark for Digital Asset Platform as Wall Street's Crypto Embrace Continues Global banking giant JPMorgan Chase has filed a trademark application for a new crypto-focused platform branded as JPMD, signaling that the bank is … By CoinDesk 2025-06-16
Bitcoin or Bust? Analyst Warns Against 'Consumptive' Crypto for Treasury Firms Ethereum, XRP, and Solana have become focal points for various crypto treasury strategies. By Decrypt 2025-06-16
Juventus Deal Vaults Crypto Exchange WhiteBIT's Token to All-Time High Price Italian soccer club Juventus has agreed to a three-year sponsorship deal with crypto exchange WhiteBIT, boosting WBTs price in the process. By Decrypt 2025-06-16
Bitcoin marches toward new highs as traders shrug off war and inflation fears !Bitcoin marches toward new highs as traders shrug off war and inflation … By Cointelegraph 2025-06-16
$1 Billion More Bitcoin for Strategy? Of Course, It’s Monday The public company made its largest Bitcoin buy since early May, scooping up 10,100 Bitcoin. By Decrypt 2025-06-16
Solana Treasury Strategy Better Than ETH, Firms Buying SOL Should Trade at Premium: Cantor Cantor initiated coverage of the three largest solana SOL treasury companies DeFi Development DFDV, Upexi UPXI and Sol Strategies HODL with an … By CoinDesk 2025-06-16
Bitcoin Mining Costs Soar as Hashrate Hits Records: TheMinerMag Bitcoin BTC miners are facing mounting pressure as the networks hashrate and difficulty continue to climb, tightening margins even as bitcoins price … By CoinDesk 2025-06-16
CoinShares Solana ETF Joins Growing List of Applications for Altcoin-Based Funds The CoinShares Solana ETF would track the sixth largest crypto by market cap and trade on the Nasdaq. By Decrypt 2025-06-16
Price predictions 6/16: SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE !Price predictions 616 SPX, DXY, BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPEimagesnewsprice-predictions-6-16-spx-dxy-btc-eth-xrp-bnb-solc8deebde89fb.jpg … By Cointelegraph 2025-06-16
Trump’s Bitcoin Bet Lifts BTC and ETH as Wall Street Panics Over Iran: Analysis The crypto market shrugged off global conflict with BTC and ETH holding the line, preventing a panic episode in the crypto scene. By Decrypt 2025-06-16
ETH price slips, but institutions flock to Ethereum staking — Lido Exec !ETH price slips, but institutions flock to Ethereum staking Lido Execimagesnewseth-price-slips-but-institutions-flock-to-ethereum5345081e1dd6.jpg … By Cointelegraph 2025-06-16
Spot XRP ETF Set to Start Trading in Canada This Week After Regulatory Nod, Token Up 7% Asset manager Purpose Investments is set to launch a spot XRP XRP exchange-traded fund ETF in Canada this week after obtaining regulatory approval, … By CoinDesk 2025-06-16
Play With Doge: Games That Feature the Dogecoin Meme Pup From a battle royale shooter to a trading card game and arcade brawler, these Dogecoin-inspired games capture the DOGE spirit. By Decrypt 2025-06-16
Litecoin Climbs Over 2% as Whale Holdings Grow and Price Breaks Key Resistance Litecoin LTC rallied more than 2 on Monday, gaining ground as investors eye a possible spot exchange-traded fund ETF approval and navigate a shaky … By CoinDesk 2025-06-16
Circle Stock Spikes to All-Time High as Ethereum Treasury SharpLink Begins Rebound Stablecoin giant Circle popped to new highs Monday, while Ethereum firm SharpLink Gaming is clawing back gains after last weeks freefall. By Decrypt 2025-06-16
Early Bitcoin adopter says BTC could have another 100X cycle !Early Bitcoin adopter says BTC could have another 100X cycleimagesnewsearly-bitcoin-adopter-says-btc-could-have-another-a6054b777db5.jpg Over the … By Cointelegraph 2025-06-16
SUI Is ‘On the Edge of a New Run Towards Highs,' Says Crypto Analyst Michaël Van De Poppe SUI SUI traded at 3.1110 on Monday, rising 3.85 over the past 24 hours following a multi-hour uptrend that pushed the token through key resistance … By CoinDesk 2025-06-16
SRM Stock Soars 580% as Justin Sun's Tron Eyes Nasdaq Debut The Florida-based theme-park supplier plans on renaming to Tron. By Decrypt 2025-06-16
Gemini, Coinbase expected to secure EU licenses under MiCA — Report !Gemini, Coinbase expected to secure EU licenses under MiCA Reportimagesnewsgemini-coinbase-expected-to-secure-eu-licenses-und80e5585641e6.jpg … By Cointelegraph 2025-06-16
TON Moves Past $3 Milestone on High Trading Volume Toncoin TON established strong support at 2.94-2.96 before making a decisive move upward, demonstrating resilience even after a sharp pullback, … By CoinDesk 2025-06-16
BNB Climbs as Transaction Activity Surges, DEX Volume Tops $100B Binance Coin BNB climbed over the last 24 hours even as geopolitical tensions rattled the markets, driven by surging usage of the BNB Chain, which … By CoinDesk 2025-06-16
Trump Media Files to Launch Truth Social Bitcoin and Ethereum ETF President Trumps company plans to launch a joint Bitcoin and Ethereum ETF under the Truth Social name, following a solo Bitcoin ETF filing. By Decrypt 2025-06-16
AVAX Rises 3% in V-Shaped Recovery, Defies Middle East Uncertainty Avalanches token AVAX has gained 3.1 in the last 24 hours and appears to be undergoing a V-shaped recovery even as the war between Iran and Israel … By CoinDesk 2025-06-16
NEAR Surges 6% to Break Key Resistance NEAR Protocol has emerged as a bright spot in the cryptocurrency sector, surging 6.1 over the past 24 hours despite the uncertain macroeconomic … By CoinDesk 2025-06-16
U.S.-Listed Bitcoin Miners' Share of Network Hashrate Hit Record High in June: JPMorgan The total hashrate of the 13 U.S.-listed bitcoin BTC miners tracked by JPMorgan JPM now accounts for around 31.5 of the global network, the highest … By CoinDesk 2025-06-16
ATOM Surges 6% as Crypto Markets Bounce Back The impact of conflict in the middle east appears to be waning with ATOM forming a clear bottoming pattern around the 4.01-4.05 support zone before … By CoinDesk 2025-06-16
Home on the (BTC) Range Hi. Im Andy Baehr with the CoinDesk Indices team. Question Bitcoin is stuck in a range. Is that a bad thing or a good thing? Even casual BTC watchers … By CoinDesk 2025-06-16
Cointelegraph joins forces with Nansen to boost crypto journalism with onchain data !Cointelegraph joins forces with Nansen to boost crypto journalism with onchain … By Cointelegraph 2025-06-16
Crypto regulation needs more technologists and fewer suits !Crypto regulation needs more technologists and fewer suitsimagesnewscrypto-regulation-needs-more-technologists-and-fewcf471a5ef56a.jpg The crypto … By Cointelegraph 2025-06-16
OCC Green-Lights Crypto Activities for Banks In recent months, the federal Office of the Comptroller of the Currency OCC has signaled a more permissible regulatory stance towards national banks … By CoinDesk 2025-06-16
SRM to build $210M TRX treasury, rebrand as Tron Inc. with Justin Sun as adviser !SRM to build 210M TRX treasury, rebrand as Tron Inc. with Justin Sun as … By Cointelegraph 2025-06-16
Coinbase, Gemini Angling for MiCA Licenses in Malta and Luxembourg: Reuters Major crypto exchanges Gemini and Coinbase near EU-wide licenses, sparking regulatory concerns about standards and race to the bottom. By Decrypt 2025-06-16
Crypto Exchange WhiteBIT's Token Jumps 30% Over Juventus Partnership The price of cryptocurrency exchange WhiteBITs token, WhiteBIT Coin WBT, climbed more than 30 in the last 24 hours after the exchange announced a … By CoinDesk 2025-06-16
From $2.5M loss to $65M gain: Inside the playbook of ‘recycled’ crypto founders !From 2.5M loss to 65M gain Inside the playbook of recycled crypto … By Cointelegraph 2025-06-16
Rethinking Sweden’s cashless society: An offline e-cash option is needed !Rethinking Swedens cashless society An offline e-cash option is neededimagesnewsrethinking-swedens-cashless-society-an-offline-e-caa965f7ed4dc.jpg … By Cointelegraph 2025-06-16
Stablecoins to Evolve Into 'Money Rail of Internet' Once GENIUS Act Is Passed: Bernstein The Senates GENIUS Acthttpswww.coindesk.compolicy20250611senate-begins-passage-of-stablecoin-bill-as-house-marks-market-structure-wins, a key piece … By CoinDesk 2025-06-16
Cointelegraph goes onchain: CTDG initiative to secure Web3 with live validators !Cointelegraph goes onchain CTDG initiative to secure Web3 with live … By Cointelegraph 2025-06-16
Donald Trump's Truth Social Files for Dual Bitcoin and Ether ETF Trump Media and Technology Group DJT has … By CoinDesk 2025-06-16
Trump’s Truth Social files S-1 for dual Bitcoin and Ether ETF !Trumps Truth Social files S-1 for dual Bitcoin and Ether ETFimagesnewstrumps-truth-social-files-s-1-for-dual-bitcoin-and56dab5f01fcf.jpg Trumps … By Cointelegraph 2025-06-16
Can you mine Bitcoin with a gaming PC? Here’s what you need to know !Can you mine Bitcoin with a gaming PC? Heres what you need to knowimagesnewscan-you-mine-bitcoin-with-a-gaming-pc-heres-what-yddeb6ef27b6f.jpg Yes, … By Cointelegraph 2025-06-16
How VCs trade token unlocks (and what you can learn from them) !How VCs trade token unlocks and what you can learn from themimagesnewshow-vcs-trade-token-unlocks-and-what-you-can-learn336328b28d0d.jpg VCs time … By Cointelegraph 2025-06-16
CoinDesk 20 Performance Update: Solana (SOL) Jumps 7.3% as All Assets Trade Higher CoinDesk Indiceshttpswww.coindesk.comindices presents its daily market update, highlighting the performance of leaders and laggards in the CoinDesk … By CoinDesk 2025-06-16
How to use AI (ChatGPT + Grok) to find the next big altcoin !How to use AI ChatGPT Grok to find the next big altcoinimagesnewshow-to-use-ai-chatgpt-grok-to-find-the-next-big-alc66d043f57fb.jpg ChatGPT and … By Cointelegraph 2025-06-16
Tron Looks to Go Public in the U.S., Form Strategy-Like TRX Holding Firm: FT Tron, the blockchain founded by billionaire Justin Sun, is looking to go public in the U.S., the Financial Times … By CoinDesk 2025-06-16
El Salvador has bought 240 Bitcoin since IMF non-accumulation agreement !El Salvador has bought 240 Bitcoin since IMF non-accumulation agreementimagesnewsel-salvador-has-bought-240-bitcoin-since-imf-non-a3154addec4ec.jpg … By Cointelegraph 2025-06-16
Hyperliquid, Solana Lead Altcoin Rally as Institutions Pour $1.9B Into Crypto Funds Major altcoins posted gains Monday morning, as nearly 2 billion flowed into institutional crypto funds. By Decrypt 2025-06-16
Cardano (ADA) Breaks Above $0.64 as Staking Addresses Top 1.3 Million Cardanos ADA ADA token climbed 3 over the past 24 hours, trading near 0.6460 at midday Monday after reaching a high of 0.6502. The price advance … By CoinDesk 2025-06-16
Strategy adds $1B in Bitcoin as Israel-Iran conflict pressures markets !Strategy adds 1B in Bitcoin as Israel-Iran conflict pressures marketsimagesnewsstrategy-adds-1b-in-bitcoin-as-israel-iran-conflica1b739c421ec.jpg … By Cointelegraph 2025-06-16
Strategy Adds Over 10K BTC to Its Bitcoin Treasury, Funded by New STRD Offering Disclaimer The analyst who wrote this piece owns shares of Strategy MSTR. Strategy MSTR, the largest corporate holder of bitcoin BTC, has expanded … By CoinDesk 2025-06-16
Why is XRP price up today? !Why is XRP price up today?imagesnewswhy-is-xrp-price-up-today66357c6c890a.jpg XRP price is up 2 on June 16, with the hopes that the Ripple-SEC … By Cointelegraph 2025-06-16
Ether Price Surges 4% as Markets Mostly Shrug Off Escalating Middle East Tensions Ether ETH ETH traded firmly above 2,600 on Monday, up 3.71 over the last 24 hours, as global markets adopted a risk-on stance despite rising … By CoinDesk 2025-06-16
Bitget and UNICEF to train 300K girls in blockchain across 8 nations !Bitget and UNICEF to train 300K girls in blockchain across 8 nationsimagesnewsbitget-and-unicef-to-train-300k-girls-in-blockchai4362e498484f.jpg … By Cointelegraph 2025-06-16
Kidnappers Release TikTok Crypto Influencer After Finding Out He’s Broke The kidnapping case is one of a growing number of 5 wrench attacks targeting cryptocurrency holders in France. By Decrypt 2025-06-16
Ethereum whales are buying the most ETH since 2018 !Ethereum whales are buying the most ETH since 2018imagesnewsethereum-whales-are-buying-the-most-eth-since-201844e1ea1914a6.jpg Ethereums drivers are … By Cointelegraph 2025-06-16
Crypto Daybook Americas: Bitcoin Holds Above $100K as Iran, Israel Trade Blows By Omkar Godbole All times ET unless indicated otherwise Bitcoins BTC continued choppy trading near Januarys highs of around 110,000 has some … By CoinDesk 2025-06-16
Alabama Regulator Recovers $125K in Crypto Lost to Pig Butchering Scams Alabama recovers 125K in crypto for victims of romance scams that cost them nearly 580K through fake dating app relationships and platforms. By Decrypt 2025-06-16
UNI Jumps 7%; Crypto Analyst Sees Breakout Momentum Toward $10 Uniswaps UNI UNI token gained 7.33 over the past 24 hours, climbing from a low of 6.9788 to a high of 7.7177 by early Monday. The token broke through … By CoinDesk 2025-06-16
Amazon to invest $13B in Australian AI data center infrastructure !Amazon to invest 13B in Australian AI data center infrastructureimagesnewsamazon-to-invest-13b-in-australian-ai-data-center-08090ec7314a.jpg Amazon … By Cointelegraph 2025-06-16
Pakistan Engages Michael Saylor in Bold Push Toward Bitcoin-Backed Economy Pakistan httpswww.finance.gov.pkpressreleases.htmlhas taken a significant leap toward integrating digital assets into its economic roadmap by hosting … By CoinDesk 2025-06-16
Hyperliquid's HYPE Becomes Fifth Largest Token in Futures Trading; XRP Remains Ahead HYPE, the token of leading decentralized perpetual exchange Hyperliquid, is now the fifth-largest digital asset by futures open interest. At the time … By CoinDesk 2025-06-16
UK Startup Optalysys Debuts Server for Blockchains Optalysys, a U.K.-based startup focused on secure computing, has introduced what it claims to be the worlds first server for blockchains that can … By CoinDesk 2025-06-16
H100 Group Targets $79 Million Raise to Power Bitcoin Strategy H100 Group H100httpsx.comH100Groupstatus1934519309939999151c, a Swedish health-technology company, said it reached an agreement that could see … By CoinDesk 2025-06-16
Ex-TON Foundation exec launches crypto investment app on Telegram !Ex-TON Foundation exec launches crypto investment app on Telegramimagesnewsex-ton-foundation-exec-launches-crypto-investment-e4399f5f6eca.jpg By … By Cointelegraph 2025-06-16
TON-Based Protocol Affluent Wants to Make Telegram a Financial Super App A TON-based money market protocol wants to make messaging platform Telegram a super app for decentralized finance DeFi. Affluent, which will be … By CoinDesk 2025-06-16
Why is Solana (SOL) price up today? !Why is Solana SOL price up today?imagesnewswhy-is-solana-sol-price-up-today9315cbd5f46c.jpg Solana is up today as increasing optimism around ETF … By Cointelegraph 2025-06-16
Vietnam Passes Landmark Law Recognizing Crypto Assets Vietnam passed a law officially recognizing digital and crypto assets, taking a decisive step toward regulating and promoting the cryptocurrency … By CoinDesk 2025-06-16
Tether blocks $12.3M in USDT tied to suspicious Tron addresses !Tether blocks 12.3M in USDT tied to suspicious Tron addressesimagesnewstether-blocks-12-3m-in-usdt-tied-to-suspicious-tro7f0e9234c85a.jpg The … By Cointelegraph 2025-06-16
$112K BTC was not ‘bull market peak’: 5 things to know in Bitcoin this week !112K BTC was not bull market peak 5 things to know in Bitcoin this weekimagesnews112k-btc-was-not-bull-market-peak-5-things-to-know3498d971339d.jpg … By Cointelegraph 2025-06-16
Crypto funds notch $1.9B of inflows as Bitcoin rebounds !Crypto funds notch 1.9B of inflows as Bitcoin reboundsimagesnewscrypto-funds-notch-1-9b-of-inflows-as-bitcoin-rebod3950c199ca5.jpg With a fresh week … By Cointelegraph 2025-06-16
Metaplanet Overtakes Coinbase With 10K BTC, Becomes No. 9 Bitcoin Holder Metaplanet 3350, the Japanese company thats committed to buying bitcoin BTC, boosted its holdings to 10,000 BTC, overtaking crypto exchange Coinbase … By CoinDesk 2025-06-16
Vietnam Passes Landmark Law Defining Digital Assets, Boosting AI and Chip Sectors The new law ends regulatory limbo for crypto while establishing massive incentives for semiconductors, AI, and digital startups. By Decrypt 2025-06-16
Metaplanet’s Bitcoin holdings hits 10,000 BTC, beating Coinbase !Metaplanets Bitcoin holdings hits 10,000 BTC, beating Coinbaseimagesnewsmetaplanets-bitcoin-holdings-hits-10000-btc-beatin75e8dba4dd0b.jpg … By Cointelegraph 2025-06-16
Bitcoin Price Volatility Signal Goes Off – Is a Surge Ahead? This is a daily technical analysis by CoinDesk analyst and Chartered Market Technician Omkar Godbole. A key indicator suggests that bitcoins BTC … By CoinDesk 2025-06-16
Bitcoin buying firms must weigh quitting as risks emerge: VanEck !Bitcoin buying firms must weigh quitting as risks emerge VanEckimagesnewsbitcoin-buying-firms-must-weigh-quitting-as-risks-fd901d70ca21.jpg … By Cointelegraph 2025-06-16
Crypto user loses $6.9M to a cold wallet from China’s TikTok !Crypto user loses 6.9M to a cold wallet from Chinas TikTokimagesnewscrypto-user-loses-6-9m-to-a-cold-wallet-from-china474d82a15073.jpg SlowMists … By Cointelegraph 2025-06-16
Bitcoin closer to equities than gold as Middle East war deepens !Bitcoin closer to equities than gold as Middle East war deepensimagesnewsbitcoin-closer-to-equities-than-gold-as-middle-eas7798be4d5d7a.jpg Gold … By Cointelegraph 2025-06-16
Trump Discloses $57M Windfall From Crypto Venture World Liberty Financial Trump has reported over 600 million in income from crypto, golf clubs, and licensing ventures in his latest federal financial disclosure. By Decrypt 2025-06-16
Digital Finance Reform Could Add Billions to Australia's Economy, New Research Shows Australia could unlock billions annually through digital finance innovation and tokenization, but key hurdles remain. By Decrypt 2025-06-16
Metaplanet Reaches 10,000 BTC Target Amid $210M Bond Issuance Metaplanet is now aiming to acquire 210,000 BTC by 2027 equivalent to roughly 1 of Bitcoins total supply By Decrypt 2025-06-16
Bybit targets Q3 launch of new Solana-based DEX Byreal !Bybit targets Q3 launch of new Solana-based DEX Byrealimagesnewsbybit-targets-q3-launch-of-new-solana-based-dex-by21455870c20b.jpg Crypto exchange … By Cointelegraph 2025-06-16
Ethereum whales, sharks keep buying up ETH as retail cashes out !Ethereum whales, sharks keep buying up ETH as retail cashes outimagesnewsethereum-whales-sharks-keep-buying-up-eth-as-retai44e1ea1914a6.jpg Crypto … By Cointelegraph 2025-06-16
Strategy’s Michael Saylor to help Pakistan with crypto pivot !Strategys Michael Saylor to help Pakistan with crypto pivotimagesnewsstrategys-michael-saylor-to-help-pakistan-with-cryb1a02edb33ce.jpg Strategy … By Cointelegraph 2025-06-16
TikTok crypto trader freed after kidnappers realized he’s broke !TikTok crypto trader freed after kidnappers realized hes brokeimagesnewstiktok-crypto-trader-freed-after-kidnappers-realiz5697d29f5aa4.jpg The … By Cointelegraph 2025-06-16
Polyhedra’s ZKJ token plummets 83% after ‘abnormal’ transactions !Polyhedras ZKJ token plummets 83 after abnormal transactionsimagesnewspolyhedras-zkj-token-plummets-83-after-abnormal-tr46b2c9e7f2b9.jpg Polyhedra … By Cointelegraph 2025-06-16
Asia Morning Briefing: Risk of Escalating Israel-Iran Conflict Keeps BTC Around 105K Says QCP Good Morning, Asia. Here s whats making news in the markets Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and an … By CoinDesk 2025-06-16
Here’s what happened in crypto today !Heres what happened in crypto todayimagesnewsheres-what-happened-in-crypto-todaycff243bd0be3.jpg Need to know what happened in crypto today? Here is … By Cointelegraph 2025-06-15
This Week in Crypto Games: Dogecoin Got Game, FIFA Rivals Launches Dogecoin is about to get a slew of games via DogeOS and PlaysOut, FIFA Rivals is live on mobile, and more from the crypto gaming world. By Decrypt 2025-06-15
AI race between US and China resembles Cold War — Marc Andreessen !AI race between US and China resembles Cold War Marc Andreessenimagesnewsai-race-between-us-and-china-resembles-cold-war-maf311022a3e62.jpg The … By Cointelegraph 2025-06-15
Bitcoin mining difficulty falls slightly from recent all-time high !Bitcoin mining difficulty falls slightly from recent all-time highimagesnewsbitcoin-mining-difficulty-falls-slightly-from-rece125070d19a7e.jpg BTC … By Cointelegraph 2025-06-15
ETH Holds Strong; Is It the ‘Digital Oil’ Powering the Global Digital Economy? Ether ETH ETH is trading above 2,540, showing strong resilience in the face of market turbulence fueled by heightened geopolitical risk. After … By CoinDesk 2025-06-15
Bitcoin DeFi Is Taking Root on Sui—Here’s How It Works Bitcoin integrations are growing across the Sui network, providing more use cases for BTC holders. Heres how BTCfi works on Sui. By Decrypt 2025-06-15
5 Prompts That Make Anthropic's Claude AI Better Than a Crypto Analyst, Broker or Doctor Think Anthropics Claude AI isnt worth the subscription? These five advanced prompts unlock its powerdelivering expert-grade investment reports, lab … By Decrypt 2025-06-15
Bitcoin holds $105K as HYPE, AAVE, BCH, OKB aim to lead altcoins higher !Bitcoin holds 105K as HYPE, AAVE, BCH, OKB aim to lead altcoins higherimagesnewsbitcoin-holds-105k-as-hype-aave-bch-okb-aim-to-leabbc2676a64cf.jpg … By Cointelegraph 2025-06-15
AI Deepfakes Drove 40% of High-Value Crypto Fraud Last Year: Report Bitget says that 4.6 billion in crypto was lost to scams in 2024, with much of that attributed to AI-generated deepfakes. By Decrypt 2025-06-15
Trump Strategist Outlines How Bitcoin Helped Republicans Win the 2024 Election Trump ally Chris LaCivita said at Coinbases Crypto Summit that the Republican Party recognized the importance of the crypto community. By Decrypt 2025-06-15
Saylor signals impending Bitcoin purchase amid Israel-Iran conflict !Saylor signals impending Bitcoin purchase amid Israel-Iran conflictimagesnewssaylor-signals-impending-bitcoin-purchase-amid-isr07bb73d27117.jpg … By Cointelegraph 2025-06-15
What Are Internet Capital Markets? Why Companies Are Launching Meme Coins Traditional stocks are old news. Now, companies are launching meme coins to fund or market their businesses. By Decrypt 2025-06-15
TradFi's deep liquidity issue is crypto's silent structural risk !TradFis deep liquidity issue is cryptos silent structural riskimagesnewstradfi-s-deep-liquidity-issue-is-crypto-s-silent-s67b11272816a.jpg Despite … By Cointelegraph 2025-06-15
7 Games That Prove Indie Studios Are Outshining AAA Publishers in 2025 Even amid smash AAA games like Assassins Creed Shadows and Mario Kart World, indie gems keep stealing the spotlight so far this year. By Decrypt 2025-06-15
Chart of the Week: Bitcoin's Summer Lull Still Offers 'Inexpensive' Trading Opportunity Hey bitcoin, Do Something! The viral meme starring a stick figure poking the ground and depicting a need for reaction might just sum up the current … By CoinDesk 2025-06-15
Why Is BlackRock's IBIT Bitcoin ETF Soaring? The success of BlackRocks spot Bitcoin fund reflects not only the companys brand recognition but also the embrace by investors, including financial … By Decrypt 2025-06-15
Bitcoin-backed loans open the real estate market to crypto-rich, tax-free !Bitcoin-backed loans open the real estate market to crypto-rich, … By Cointelegraph 2025-06-15
Shiba Inu Price Sell-Off Continues as SHIB Burn Rate Skyrockets to 112,000% Shiba inus SHIB supply-side dynamics are screaming bullish, yet the second-largest joke cryptocurrency by market value trades under pressure. Early … By CoinDesk 2025-06-15
10 red flags a crypto platform is a scam—and how to protect your money !10 red flags a crypto platform is a scamand how to protect your moneyimagesnews10-red-flags-a-crypto-platform-is-a-scam-and-how-t7e29edc181fd.jpg … By Cointelegraph 2025-06-15
How to stake Solana (SOL) in 2025: A step-by-step guide for beginners !How to stake Solana SOL in 2025 A step-by-step guide for beginnersimagesnewshow-to-stake-solana-sol-in-2025-a-step-by-step-gui208dec51f2d5.jpg To … By Cointelegraph 2025-06-15
Bitcoin price targets mushroom as traders bet on $140K+ this bull run !Bitcoin price targets mushroom as traders bet on 140K this bull runimagesnewsbitcoin-price-targets-mushroom-as-traders-bet-on-1cece390a1ddc.jpg From … By Cointelegraph 2025-06-15
Vietnam legalizes crypto under new digital technology law !Vietnam legalizes crypto under new digital technology lawimagesnewsvietnam-legalizes-crypto-under-new-digital-technolb54836d4deba.jpg Vietnam has … By Cointelegraph 2025-06-15
Brazil ends crypto tax exemption, imposes 17.5% flat rate on gains !Brazil ends crypto tax exemption, imposes 17.5 flat rate on gainsimagesnewsbrazil-ends-crypto-tax-exemption-imposes-17-5-flata948de2f9b97.jpg Brazil … By Cointelegraph 2025-06-15
Owning One Bitcoin Is the New American Dream, Says Bitwise Portfolio Manager Bitcoin BTC BTC is holding firm above 105,000 after recovering from a sharp downturn triggered by escalating tensions in the Middle East. The leading … By CoinDesk 2025-06-15
Stablecoins will soon have their ‘iPhone moment,’ Circle CEO !Stablecoins will soon have their iPhone moment, Circle CEOimagesnewsstablecoins-will-soon-have-their-iphone-moment-cir62cacd100e31.jpg The CEO of … By Cointelegraph 2025-06-15
Crypto Fear & Greed Index stays in greed territory amid Israel-Iran conflict !Crypto Fear Greed Index stays in greed territory amid Israel-Iran … By Cointelegraph 2025-06-15
IBM’s New Quantum Roadmap Brings the Bitcoin Threat Closer IBMs Starling system may shorten the timeline for quantum computers to challenge Bitcoins cryptographic foundations. By Decrypt 2025-06-14
Bitcoin ETFs record 5-day inflow streak amid geopolitical tensions !Bitcoin ETFs record 5-day inflow streak amid geopolitical tensionsimagesnewsbitcoin-etfs-record-5-day-inflow-streak-amid-geopo4657db45a713.jpg … By Cointelegraph 2025-06-14
Amazon signs nuclear energy deal to power AI data centers !Amazon signs nuclear energy deal to power AI data centersimagesnewsamazon-signs-nuclear-energy-deal-to-power-ai-data-dc74fc967a8f.jpg Amazon joins a … By Cointelegraph 2025-06-14
Russia Paying Teenage and Untrained Spies Using Bitcoin: Report Russias intelligence agencies are constantly financing agents using cryptocurrency, blockchain investigators told Decrypt. By Decrypt 2025-06-14
ADA Hovers Around $0.62 as New Enterprise Product Launch Offsets Whale-Driven Pressure Cardanos ADA ADA was down 1.71 over the past 24 hours, trading at 0.6229 as of June 14. The asset briefly slipped to 0.6176 before stabilizing, … By CoinDesk 2025-06-14
ETH Whales and Sharks Accumulate 1.49M ETH in 30 Days as Retail Pulls Back Ether ETH ETH traded at 2,508 on June 14, down 0.88 in the past 24 hours, yet managed to hold support above the 2,500 level despite shifting … By CoinDesk 2025-06-14
Trump's Drone Deregulation Raises Fears of Domestic Terror Strikes President Trumps recent executive orders promise innovation, but critics warn they arrive amid a deadly surge in drone-powered conflict from Ukraine … By Decrypt 2025-06-14
Litecoin Price Struggles Despite ETF Optimism as War Tensions Rattle Market Litecoin LTC fell more than 4.3 over the past week, and is down more than 14 for the last 30-day period, with the latest sell-off coming as part of a … By CoinDesk 2025-06-14
SOL Rebounds Toward $145 as 7 ETFs Advance and DeFi Dev Corp Eyes More SOL Purchases Solana SOL SOL traded at 144.14 on June 14, down 2.06 over the past 24 hours, but showed resilience as long-term institutional activity offset … By CoinDesk 2025-06-14
Trump's Empire Pulled In $57M From Family-Linked Crypto Firm Last Year, Filing Shows Donald Trumps crypto wallet and branding empire earned tens of millions of dollars last year, with World Liberty Financial netting the U.S. President … By CoinDesk 2025-06-14
BNB Price Remains Above Key Support Level After Israel-Iran Clash Sparks Risk Asset Flight Binance Coin BNB is showing resilience after a stormy week for financial markets, as Israel attacked … By CoinDesk 2025-06-14
Brazil Sets Flat 17.5% Tax on Crypto Profits, Ending Exemption for Smaller Investors Brazil has scrapped a long-standing tax exemption on cryptocurrency gains, with a new provisional measure MP … By CoinDesk 2025-06-14
Shaquille O’Neal to Pay $1.8M in Settlement Over FTX Promotion Lawsuit NBA legend Shaquille ONeal has agreed to pay 1.8 million to settle a class-action lawsuit brought by investors in the collapsed crypto exchange FTX, … By CoinDesk 2025-06-14
How Immigrants and Protesters Are Being Caught in ICE’s AI Dragnet Federal agents are using AI, facial recognition, and drones to monitor protests and immigrants. But is its increasing use warranted? By Decrypt 2025-06-14
Why Are So Many Public Companies Pivoting to Crypto, And What Happens If Bitcoin Crashes? Although some firms may be forced to sell their Bitcoin if markets cool, others could be acquired by asset managers hunting for deals. By Decrypt 2025-06-14
Crypto-Related Anti-Money Laundering Reports Rose by 8% in Germany Last Year: FIU Crypto figured in a record 3.3 of all suspicious activity reports submitted to Germanys anti-money laundering agency last year. By Decrypt 2025-06-14
Bitcoin Remains Defiant Amid Escalating Middle East Conflict and Trade War Fears Bitcoin hovered around 105,100 on June 14, down 0.22 over the past 24 hours as traders digested geopolitical tension. Price action remained … By CoinDesk 2025-06-14
How Will the Israel-Iran Conflict End? Here's What AI Models Predict We asked seven leading AI models to analyze the most plausible scenario for how the conflict between Israel and Iran will play out. By Decrypt 2025-06-13
Solana ETF Applicants Submit Updated SEC Filings With Staking Prospective Solana ETF issuers in the United States submitted updated SEC filings Friday, suggesting approvals may be near. By Decrypt 2025-06-13
Public Keys: Circle Keeps Surging, GameStop's Bitcoin 'Black Box', Ethereum Treasury Tanks Circles stock soared again while GameStop shares swoonedbut SharpLink Gamings fall takes the cake on a busy week. By Decrypt 2025-06-13
Bitcoin Treasury Firm GameStop Boosts Convertible Bond Offering to $2.25 Billion Shares fell earlier this week after the Texas-based video game retailer announced plans to offer 1.75 billion in convertible bonds. By Decrypt 2025-06-13
Elizabeth Warren, Consumer Groups Slam Walmart and Amazon Stablecoin Plans Retailers Amazon and Walmart are considering issuing their own stablecoins, according to a Friday report in the Wall Street Journal. By Decrypt 2025-06-13
Bitcoin flash crash presents prime buy opportunity if historic pattern repeats !Bitcoin flash crash presents prime buy opportunity if historic pattern … By Cointelegraph 2025-06-13
Gotbit Got Got: Founder Sentenced to Prison for Crypto Wash Trading Gotbit forfeited $23 million in cryptocurrency after a guilty plea in the fraud case, with founder Aleksei Andriunin sentenced to prison. By Decrypt 2025-06-13
Gotbit Got Got: Founder Sentenced to Prison for Crypto Wash Trading Gotbit forfeited 23 million in cryptocurrency after a guilty plea in the fraud case, with founder Aleksei Andriunin sentenced to prison. By Decrypt 2025-06-13
Ethereum Foundation pledges $500K to Roman Storm’s defense !Ethereum Foundation pledges $500K to Roman Storm’s defense/images/news/ethereum-foundation-pledges-500k-to-roman-storms-d/860c53e07d9a.jpg Roughly … By Cointelegraph 2025-06-13
Bitcoin Bounces to $106K After Iran-Israel Jitters, but Analysts Warn of Deeper Pullback The crypto market is slightly bouncing back from early Friday’s jitters on escalating conflict between Israel and Iran. After slumping to the … By CoinDesk 2025-06-13
Bitcoin Bounces to $106K After Iran-Israel Jitters, but Analysts Warn of Deeper Pullback The crypto market is slightly bouncing back from early Fridays jitters on escalating conflict between Israel and Iran. After slumping to the 102,600 … By CoinDesk 2025-06-13
Meet Olto: The $3,500 E-Scooter Gunning to Be the iPhone of Micromobility Infinite Machine’s new Olto is a sleek, connected, e-scooter designed for bike lane commuters. By Decrypt 2025-06-13
Meet Olto: The $3,500 E-Scooter Gunning to Be the iPhone of Micromobility Infinite Machines new Olto is a sleek, connected, e-scooter designed for bike lane commuters. By Decrypt 2025-06-13
Circle’s NYSE debut marks start of crypto IPO season: Are Kraken, Gemini and Bullish next? !Circle’s NYSE debut marks start of crypto IPO season: Are Kraken, Gemini and Bullish … By Cointelegraph 2025-06-13
Dogecoin Leads Meme Coin Dive as Geopolitical Tensions Slam Crypto Market Leading meme coins are not immune to the market’s sell-off, with Dogecoin, Fartcoin, Pepe, and other meme giants plunging. By Decrypt 2025-06-13
Dogecoin Leads Meme Coin Dive as Geopolitical Tensions Slam Crypto Market Leading meme coins are not immune to the markets sell-off, with Dogecoin, Fartcoin, Pepe, and other meme giants plunging. By Decrypt 2025-06-13
Crypto Biz: Meta’s AI bet, Fortune 500’s stablecoin push !Crypto Biz: Meta’s AI bet, Fortune 500’s stablecoin push/images/news/crypto-biz-metas-ai-bet-fortune-500s-stablecoin-pu/6ce089cc6b7b.jpg Mark … By Cointelegraph 2025-06-13
Nobody Predicted Israel Would Strike Iran, But Bitcoin Is Still Not in Panic Mode: Analysis Bitcoin dips below $106K but avoids full-blown panic as traders assess fallout from Israeli airstrikes on Iran. By Decrypt 2025-06-13
Nobody Predicted Israel Would Strike Iran, But Bitcoin Is Still Not in Panic Mode: Analysis Bitcoin dips below 106K but avoids full-blown panic as traders assess fallout from Israeli airstrikes on Iran. By Decrypt 2025-06-13
SUI Drops 10% to $3.02, but Is a Turnaround Forming After Buyers Step In Near $3? Sui SUI SUI dropped 9.64% to $3.0211 on June 13, extending a steep overnight correction that saw the token fall from $3.34 to an intraday low of … By CoinDesk 2025-06-13
SUI Drops 10% to $3.02, but Is a Turnaround Forming After Buyers Step In Near $3? Sui SUI SUI dropped 9.64 to 3.0211 on June 13, extending a steep overnight correction that saw the token fall from 3.34 to an intraday low of 2.9556. … By CoinDesk 2025-06-13
Saylor says Bitcoin could fix Apple’s stock buybacks: Finance Redefined !Saylor says Bitcoin could fix Apple’s stock buybacks: Finance … By Cointelegraph 2025-06-13
Weekly Recap: Milestones Galore for Stablecoins First slowly, then all at once. For years, crypto toiled in the darkness, a band of outlaws frowned upon by elites in Washington and in the media. … By CoinDesk 2025-06-13
Weekly Recap: Milestones Galore for Stablecoins First slowly, then all at once. For years, crypto toiled in the darkness, a band of outlaws frowned upon by elites in Washington and in the media. … By CoinDesk 2025-06-13
Solana's SOL Falls 8% to $147 Despite Standard Chartered’s $275 Year-End Target Solana's SOL SOL dropped 7.87% to $147.07 over the past 24 hours, as traders reacted to renewed volatility across crypto markets. After opening at … By CoinDesk 2025-06-13
Solana's SOL Falls 8% to $147 Despite Standard Chartered’s $275 Year-End Target Solanas SOL SOL dropped 7.87 to 147.07 over the past 24 hours, as traders reacted to renewed volatility across crypto markets. After opening at … By CoinDesk 2025-06-13
Price predictions 6/13: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, SUI, LINK !Price predictions 6/13: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, SUI, … By Cointelegraph 2025-06-13
Weeks Before Trial, Tornado Cash’s Roman Storm Sounds Alarm: ‘If I Lose, DeFi Dies With Me’ The software developer is set to go to trial next month over his operation of the popular coin mixer, despite recent moves by the Trump DOJ to back … By Decrypt 2025-06-13
Weeks Before Trial, Tornado Cash’s Roman Storm Sounds Alarm: ‘If I Lose, DeFi Dies With Me’ The software developer is set to go to trial next month over his operation of the popular coin mixer, despite recent moves by the Trump DOJ to back … By Decrypt 2025-06-13
SEC Names Crypto Industry Veteran as Trading and Markets Director The SEC has named Jamie Selway, who has experience in the crypto industry, as its new director of the trading and markets division. By Decrypt 2025-06-13
SEC Names Crypto Industry Veteran as Trading and Markets Director The SEC has named Jamie Selway, who has experience in the crypto industry, as its new director of the trading and markets division. By Decrypt 2025-06-13
Closing Strait of Hormuz is biggest risk to BTC price this weekend — Analyst !Closing Strait of Hormuz is biggest risk to BTC price this weekend — … By Cointelegraph 2025-06-13
ADA Drops 6% as Cardano Community Debates $100M Stablecoin Liquidity Proposal Cardano’s ADA token declined 6.01% to $0.6412 as the market reacted to both macro volatility and a heated governance debate over a proposed $100 … By CoinDesk 2025-06-13
ADA Drops 6% as Cardano Community Debates $100M Stablecoin Liquidity Proposal Cardanos ADA token declined 6.01 to 0.6412 as the market reacted to both macro volatility and a heated governance debate over a proposed 100 million … By CoinDesk 2025-06-13
NEAR Protocol Surges 4% After 12.8% Correction, User Growth Shines Conflict between Israel and Iran spurred a crypto market sell-off on Friday, with NEAR Protocol experiencing significant price volatility despite … By CoinDesk 2025-06-13
ATOM Tumbles 9% as Crypto Market Plunges Amid Middle East Tensions The cryptocurrency ATOM has experienced significant volatility amid growing concerns about the situation in the middle east. Israel started a bombing … By CoinDesk 2025-06-13
SharpLink Acquires $463M in Ether, Shares Remain 66% Lower SharpLink Gaming SBET, the public firm pivoting to a crypto treasury strategy focused on Ethereum, revealed on Friday it acquired 176,271 ether ETH … By CoinDesk 2025-06-13
UNI Drops Hard After V-Shaped Rebound Fizzles Amid Mounting Middle East Tension Uniswap’s UNI UNI token is down 6.36% to $7.3864 over the past 24 hours, as traders absorbed another wave of geopolitical tension following an … By CoinDesk 2025-06-13
How to legally stake crypto in 2025: What is now allowed after the SEC’s latest move !How to legally stake crypto in 2025: What is now allowed after the SEC’s latest … By Cointelegraph 2025-06-13
Crypto legislation in the US is at a ‘critical’ juncture, says industry exec !Crypto legislation in the US is at a ‘critical’ juncture, says industry … By Cointelegraph 2025-06-13
Panic or opportunity? What crypto capitulation tells smart investors !Panic or opportunity? What crypto capitulation tells smart investors/images/news/panic-or-opportunity-what-crypto-capitulation-tell/3bbe8281b764.jpg … By Cointelegraph 2025-06-13
Bitcoin clings to $105K as opinions diverge on oil price outlook !Bitcoin clings to $105K as opinions diverge on oil price outlook/images/news/bitcoin-clings-to-105k-as-opinions-diverge-on-oil-/4ed1f99ce541.jpg Oil … By Cointelegraph 2025-06-13
America’s Dollar Dominance Depends on GENIUS We are closer than ever to cementing America’s global leadership in digital asset innovation. Next week, the Senate will hold its final vote on the … By CoinDesk 2025-06-13
SharpLink Gaming Buys $463 Million in Ethereum, Becomes Largest ETH Treasury Firm The company’s announcement follows confusion over a recent SEC filing and shares tumbling around 70% in after-hours trading on Thursday. By Decrypt 2025-06-13
SharpLink Gaming Buys $463 Million in Ethereum, Becomes Largest ETH Treasury Firm The companys announcement follows confusion over a recent SEC filing and shares tumbling around 70 in after-hours trading on Thursday. By Decrypt 2025-06-13
US Senate to vote on amended stablecoin bill on June 17 !US Senate to vote on amended stablecoin bill on June 17/images/news/us-senate-to-vote-on-amended-stablecoin-bill-on-ju/930abe2a7f06.jpg Though … By Cointelegraph 2025-06-13
Positive U.S. Regulatory Environment More Conducive for Crypto Corporate Activity: JPMorgan Expectations of a more benign regulatory environment in the U.S. is leading to an increase in the number of crypto companies looking to go public and … By CoinDesk 2025-06-13
AVAX Plunges 13% as Crypto Sinks on Rise in Mideast Tensions The cryptocurrency market is experiencing significant volatility due to Israel’s strikes on Iran. Avalanche AVAX has been particularly affected, … By CoinDesk 2025-06-13
Crypto Plunges, Israel strikes Iran, Gold & Oil Soar Crypto Plunges, Israel strikes Iran, Gold & Oil Soar FOMO HOUR EP378 Crypto plunges as Israel strikes Iran. $1.1bn liquidations, Wynn liquidated … By Decrypt 2025-06-13
Blockchain is the missing trust layer in sports analytics !Blockchain is the missing trust layer in sports analytics/images/news/blockchain-is-the-missing-trust-layer-in-sports-an/9ddfaa6baf70.jpg Blockchain … By Cointelegraph 2025-06-13
ETF filings explode in 2025, heating hopes of an ‘altcoin summer’ !ETF filings explode in 2025, heating hopes of an ‘altcoin summer’/images/news/etf-filings-explode-in-2025-heating-hopes-of-an-al/c01d687f5607.jpg … By Cointelegraph 2025-06-13
TON Down 8% After Israeli Strikes Against Iran Telegram’s token TON dipped 8% in 24 hours, dropping from $3.20 to a low of $2.93 with significant selling pressure, according to CoinDesk research’s … By CoinDesk 2025-06-13
How a YouTuber hacked an $800K crypto scam hub in Cebu, Philippines !How a YouTuber hacked an $800K crypto scam hub in Cebu, Philippines/images/news/how-a-youtuber-hacked-an-800k-crypto-scam-hub-in-c/538d2836d9d9.jpg … By Cointelegraph 2025-06-13
Brazilian Firm Meliuz's Shares Fall After Planning to Raise $32.4M to Buy Bitcoin Brazilian fintech firm Meliuz CASH3 plans to raise R180.08 million $32.4 million through an equity offering, according to a … By CoinDesk 2025-06-13
Bitcoin Miners Just Had One of Their Best Quarters on Record, JPMorgan Says The first quarter of 2025 was one of the best periods on record for U.S.-listed bitcoin BTC mining companies, Wall Street bank JPMorgan JPM said in a … By CoinDesk 2025-06-13
Why Did Bitcoin Dip as Gold Surged Amid Israel-Iran Tensions? Analysts told Decrypt that the alpha crypto's risk-asset behavior contrasts with gold's safe-haven rally, splitting the reaction. By Decrypt 2025-06-13
SharpLink buys $463M in ETH, becomes largest public ETH holder !SharpLink buys $463M in ETH, becomes largest public ETH holder/images/news/sharplink-buys-463m-in-eth-becomes-largest-public-/223d62490833.jpg While … By Cointelegraph 2025-06-13
CoinDesk 20 Performance Update: Bitcoin Price (BTC) Falls 2.2% as All Assets Decline CoinDesk Indiceshttps://www.coindesk.com/indices/ presents its daily market update, highlighting the performance of leaders and laggards in the … By CoinDesk 2025-06-13
Bitcoin Miner Price Targets Raised to Reflect Improved Industry Economics: JPMorgan JPMorgan JPM raised its price targets for a number of bitcoin BTC mining companies to reflect first-quarter results and changes to the bitcoin price … By CoinDesk 2025-06-13
Cardano's Charles Hoskinson Suggests Swapping $100M of ADA for Bitcoin, Stablecoins Cardano co-founder Charles Hoskinson has floated the idea of converting $100 million worth of ADA tokens into bitcoin BTC and stablecoins. "We could … By CoinDesk 2025-06-13
How to use Grok for real-time crypto trading signals !How to use Grok for real-time crypto trading signals/images/news/how-to-use-grok-for-real-time-crypto-trading-signa/39dc24d702e4.jpg Grok scans … By Cointelegraph 2025-06-13
BlackRock quietly accumulated 3% of all Bitcoin. Here’s what that means !BlackRock quietly accumulated 3% of all Bitcoin. Here’s what that … By Cointelegraph 2025-06-13
Bitcoin mirrors 80% rally setup that preceded 2024 Israel-Iran conflict !Bitcoin mirrors 80% rally setup that preceded 2024 Israel-Iran … By Cointelegraph 2025-06-13
Tencent Is Looking to Buy Nexon, the Creator of Web 3 Gaming Franchise MapleStory Chinese tech giant Tencent is exploring a potential acquisition of Nexon, the South Korean game developer behind the hit title Dungeon & Fighter, … By CoinDesk 2025-06-13
Ether Plunges 7% as Traders Flee to Dollar and Gold After Israel Strikes Iran Ether ETH ETH tumbled more than 7% over the past 24 hours, falling from a session high of $2,770.56 to as low as $2,477.71 before recovering slightly … By CoinDesk 2025-06-13
Altcoins Plunge, Crypto Liquidations Hit $1B Amid Israel-Iran Tensions Major crypto liquidations sweep the market as altcoins plummet in response to rising tensions in the Middle East. By Decrypt 2025-06-13
Crypto Daybook Americas: Bitcoin Weathers Market Rout as Israel Hits Iran By Francisco RodriguesAll times ET unless indicated otherwise Cryptocurrencies slid as Israeli airstrikes on Iran's nuclear and missile sites roiled … By CoinDesk 2025-06-13
Bitcoin 2025 builders predict DeFi will unseat traditional finance !Bitcoin 2025 builders predict DeFi will unseat traditional finance/images/news/bitcoin-2025-builders-predict-defi-will-unseat-tra/e7882ea8696e.jpg … By Cointelegraph 2025-06-13
Walmart, Amazon Mull Dollar-Pegged Stablecoins in the U.S.: WSJ Walmart WMT and Amazon AMZN are considering issuing their own stablecoins in the United States, according to a report by the Wall Street … By CoinDesk 2025-06-13
Anthony Pompliano to lead new Bitcoin-buying group raising $750M: FT !Anthony Pompliano to lead new Bitcoin-buying group raising $750M: FT/images/news/anthony-pompliano-to-lead-new-bitcoin-buying-group/2b1664470a49.jpg … By Cointelegraph 2025-06-13
Obama Campaign Strategist David Plouffe Joins Coinbase Advisory Council The political mastermind joins Trump's ex-campaign manager at Coinbase as the crypto firm deepens its bipartisan strategy. By Decrypt 2025-06-13
Walmart, Amazon consider issuing own stablecoins: WSJ !Walmart, Amazon consider issuing own stablecoins: WSJ/images/news/walmart-amazon-consider-issuing-own-stablecoins-ws/0dc95be7f84c.jpg Retail giants … By Cointelegraph 2025-06-13
Meta Invests $14 Billion in Scale AI to ‘Deepen’ its Work on Superintelligence The deal values data-labeling startup Scale AI at $29 billion, as Meta aims to catch up with rivals such as OpenAI and Google. By Decrypt 2025-06-13
Polkadot community split on selling 500K DOT for Bitcoin reserve !Polkadot community split on selling 500K DOT for Bitcoin reserve/images/news/polkadot-community-split-on-selling-500k-dot-for-b/c20dd351e611.jpg … By Cointelegraph 2025-06-13
Bitcoin price Bollinger Bands 'failure' risks end of uptrend at $112K !Bitcoin price Bollinger Bands 'failure' risks end of uptrend at … By Cointelegraph 2025-06-13
GameStop shares tank 22% after boosting raise to $2.25B for Bitcoin strategy !GameStop shares tank 22% after boosting raise to $2.25B for Bitcoin … By Cointelegraph 2025-06-13
XRP Could Capture 14% of SWIFT’s Global Volume, Ripple CEO Says SINGAPORE — Ripple CEO Brad Garlinghouse is betting big on XRP’s XRP role in the future of cross-border payments, saying the token could capture 14% … By CoinDesk 2025-06-13
Why is the crypto market down today? !Why is the crypto market down today?/images/news/why-is-the-crypto-market-down-today/65a1ebf61c98.jpg Crypto market volatility rises in reaction to … By Cointelegraph 2025-06-13
Anthony Pompliano Set to Head $750M Bitcoin Investment Vehicle: FT Anthony Pompliano, a digital assets influencer and podcast host, is set to become CEO of ProCapBTC, a new investment vehicle aiming to acquire large … By CoinDesk 2025-06-13
Ripple, SEC File Joint Motion to Release $125M Held in Escrow The SEC and Ripple have moved to close the chapter on one of crypto’s longest-running legal battles, jointly filing a motion in Manhattan federal … By CoinDesk 2025-06-13
XRP, SOL Poised to Take Off Amid Rocketing Institutional Demand, Analyst Says Volatility in crypto markets is rising, but smart money is clustering around some major tokens with booming onchain ecosystems. Crypto markets … By CoinDesk 2025-06-13
Shopify launches early access to USDC stablecoin payments on Base !Shopify launches early access to USDC stablecoin payments on Base/images/news/shopify-launches-early-access-to-usdc-stablecoin-p/f5f6071304a7.jpg … By Cointelegraph 2025-06-13
KuCoin expands into Thailand with SEC-approved exchange !KuCoin expands into Thailand with SEC-approved exchange/images/news/kucoin-expands-into-thailand-with-sec-approved-exc/6e217ff1a59f.jpg KuCoin … By Cointelegraph 2025-06-13
Single Bitcoin Trader Loses $200M as Crypto Bulls See $1B Liquidations Crypto bulls took a heavy beating on Thursday with over $1.15 billion in liquidations wiping out leveraged positions across major exchanges, marking … By CoinDesk 2025-06-13
Thai Police Arrest Chinese Suspect in $6.1 Million Bitcoin Fraud Case Two Chinese victims lost their Bitcoin after a business meeting in Mae Sai district, transferring funds in two separate transactions. By Decrypt 2025-06-13
Cynthia Lummis Proposes Artificial Intelligence Bill, Requiring AI Firms to Disclose Technicals Senator Cynthia Lummis R-WY has introduced the Responsible Innovation and Safe Expertise RISE Act of … By CoinDesk 2025-06-13
My Big Coin execs to pay nearly $26M in fines to CTFC !My Big Coin execs to pay nearly $26M in fines to CTFC/images/news/my-big-coin-execs-to-pay-nearly-26m-in-fines-to-ct/63446ceae6a2.jpg The CFTC said … By Cointelegraph 2025-06-13
Huione darknet humming at ‘full capacity’ despite shutdown !Huione darknet humming at ‘full capacity’ despite shutdown/images/news/huione-darknet-humming-at-full-capacity-despite-sh/321126544a86.jpg Despite … By Cointelegraph 2025-06-13
Coinbase Launches Bitcoin Rewards Card to Drive Subscriber Growth Coinbase has launched a Bitcoin rewards credit card, with possible plans to support multiple tokens over time, Decrypt was told. By Decrypt 2025-06-13
Bitcoin slides to $103K as Israel launches airstrikes on Iran !Bitcoin slides to $103K as Israel launches airstrikes on Iran/images/news/bitcoin-slides-to-103k-as-israel-launches-airstrik/f10632a70674.jpg Jan3 … By Cointelegraph 2025-06-13
Barbie, Hot Wheels Toy Maker to Use OpenAI Tech to Boost Productivity Mattel will retain full control of its brands while using AI to develop new products, with the first launch expected later this year. By Decrypt 2025-06-13
Czech government hit with no-confidence vote over $45M Bitcoin scandal !Czech government hit with no-confidence vote over $45M Bitcoin … By Cointelegraph 2025-06-13
SEC axes Biden-era proposed crypto rules in flurry of repeals !SEC axes Biden-era proposed crypto rules in flurry of repeals/images/news/sec-axes-biden-era-proposed-crypto-rules-in-flurry/031dbae714cd.jpg The … By Cointelegraph 2025-06-13
Ripple, SEC Ask Court to Dissolve XRP Injunction, Release $125M in Escrow The joint filing proposes a $50 million payment to the SEC and marks a key step toward settling the years-long legal battle over XRP sales. By Decrypt 2025-06-13
Former NBA Star Shaquille O'Neal Agrees to Pay $1.8M to Settle FTX Suit The agreement marks one of the first major financial settlements against celebrities who promoted FTX before its spectacular collapse. By Decrypt 2025-06-13
CFTC’s Pham says it won’t give ‘easy street’ to anybody, crypto included !CFTC’s Pham says it won’t give ‘easy street’ to anybody, crypto … By Cointelegraph 2025-06-13
Sharplink Gaming drops 73% amid looming $1B Ethereum buy !Sharplink Gaming drops 73% amid looming $1B Ethereum buy/images/news/sharplink-gaming-drops-73-amid-looming-1b-ethereum/febec70c103b.jpg A crypto … By Cointelegraph 2025-06-13
SEC Adds Dogecoin, Hedera ETFs to Growing List of Delayed Decisions The SEC has delayed decisions on crypto ETF proposals, including Dogecoin and HBAR, while seeking further public input. By Decrypt 2025-06-13
Australia bans financial adviser for 10 years for $9.6M crypto scam !Australia bans financial adviser for 10 years for $9.6M crypto scam/images/news/australia-bans-financial-adviser-for-10-years-for-/3bf8b37ec1d2.jpg … By Cointelegraph 2025-06-13
Big Brains, Tiny Models: Spain’s Multiverse Computing Bags $215M to Shrink AI for Smartphones Multiverse Computing claims its quantum-inspired compression tech can get large AI models like Llama-2 to fit on a smartphone. By Decrypt 2025-06-13
Asia Morning Briefing: Could 3AC and Terraform be Blamed for Singapore's Crackdown on Offshore Crypto Firms? Good Morning, Asia. Here 's what's making news in the markets: Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and … By CoinDesk 2025-06-13
Bitcoin 'Skew' Slides as Oil Prices Surge 6% on Israel-Iran Tensions Bitcoin's BTC hort-term options skew crashed during the early Asian hours as traders sought downside protection amid escalating tensions in the … By CoinDesk 2025-06-13
Bitcoin Dips as Israel Launches Airstrikes on Iran Bitcoin fell sharply late Thursday after Israel launched strikes on Iran, rattling global markets and sparking a flight from risk assets. By Decrypt 2025-06-13
Billionaire Investor Calls No-Interest Stablecoins ‘Outrageous’ as Key US Bill Advances Billionaire investor Philippe Laffont called non-yielding stablecoins “outrageous,” as U.S. lawmakers move to ban interest-bearing tokens. By Decrypt 2025-06-13
Bitcoin Tumbles Below $104K as Israel Strikes Iran Bitcoin BTC has substantially added to earlier losses, now down more than 4% over the past 24 hours to $103,900 as Israeli forces have bombed targets … By CoinDesk 2025-06-13
Ethereum Treasury Firm SharpLink Gaming Plunges 70% – But There May Be a Twist SharpLink Gaming SBET, a Nasdaq-listed company that is pursuing an ether ETH treasury strategy, tumbled 70% on Thursday in after-hours trading … By CoinDesk 2025-06-12
'Attack of the Clones': Coinbase Raises Alarm on Risks With Bitcoin Treasury Model A Coinbase analyst warned that the trend of publicly traded companies whipping up Bitcoin treasuries could trigger “systemic risks” for all of crypto. By Decrypt 2025-06-12
Ethereum Treasury Company SharpLink Gaming Plunges 70% Amid SEC Filing Confusion Following a recent surge fueled by its embrace of Ethereum, SharpLink Gaming's stock price plummeted late Thursday. By Decrypt 2025-06-12
Tencent explores purchase of Nexon gaming company !Tencent explores purchase of Nexon gaming company/images/news/tencent-explores-purchase-of-nexon-gaming-company/166583a542c3.jpg Talks of a … By Cointelegraph 2025-06-12
Shopify to Roll Out USDC Stablecoin Payments on Base in Coinbase Team-Up Customers buying from Shopify merchants will be able to use the USDC stablecoin thanks to a collaboration with Coinbase and Stripe. By Decrypt 2025-06-12
Another Public Company Goes Hard on XRP With $500 Million Treasury Plan Singapore-based Trident is bucking the Bitcoin reserve trend, instead embracing the Ripple-linked XRP for its treasury. By Decrypt 2025-06-12
Solana futures open interest hits $7.4B amid ETF speculation: Is $200 SOL next? !Solana futures open interest hits $7.4B amid ETF speculation: Is $200 SOL … By Cointelegraph 2025-06-12
Crypto Longs Get Rekt as Bitcoin, Ethereum and Dogecoin Dive Long position liquidations are rapidly piling up as Bitcoin, Ethereum, Dogecoin, and Solana losses accelerate Thursday. By Decrypt 2025-06-12
Crypto Cracks Late in Day, Bitcoin Slumps Below $106K Cryptocurrencies were broadly lower on Thursday, with the selloff picking up steam in the early U.S. evening hours. Bitcoin BTC slipped more than … By CoinDesk 2025-06-12
Shift to digital asset technology won't be 'slow' — Franklin Templeton CEO !Shift to digital asset technology won't be 'slow' — Franklin Templeton … By Cointelegraph 2025-06-12
Coinbase to Launch Bitcoin Rewards Card With Amex, While Eyeing U.S. Futures Expansion Crypto exchange Coinbase is planning to launch a credit card that offers bitcoin BTC cashback, the company said on Thursday. The Coinbase One Card, … By CoinDesk 2025-06-12
'FIFA Rivals' Launches—Why Mythical Games Thinks It'll Hit Bigger Than 'NFL Rivals' Mobile soccer game FIFA Rivals launched on Thursday, pairing the "beautiful game" with blockchain on iOS and Android. By Decrypt 2025-06-12
Ex-Kamala Harris campaign adviser joins Coinbase advisory council !Ex-Kamala Harris campaign adviser joins Coinbase advisory council/images/news/ex-kamala-harris-campaign-adviser-joins-coinbase-a/f48f09717631.jpg … By Cointelegraph 2025-06-12
Trump’s Big Beautiful Bill could trigger a US debt crisis and Bitcoin boom !Trump’s Big Beautiful Bill could trigger a US debt crisis and Bitcoin … By Cointelegraph 2025-06-12
Myriad Moves: Will Strategy Boost Its Bitcoin Buys? Also Predictions on Fartcoin’s Rise and FIFA Club World Cup This week's top Myriad markets include predictions on Fartcoin, Strategy's Bitcoin treasury plans, and FIFA Club World Cup. By Decrypt 2025-06-12
Publicly Traded Solana Treasury Company Wants to Stack Another $5 Billion in SOL Solana treasury company DeFi Development Corp. established a major line of equity credit to buy even more SOL. By Decrypt 2025-06-12
Ethereum Token Platform Zora Sues Deloitte Over AI Trademark Dispute Token launchpad Zora is suing consulting giant Deloitte for trademark infringement over its "Zora AI" digital workforce platform. By Decrypt 2025-06-12
Shopify to Enable USDC Payments on Coinbase's Base for Merchants Worldwide E-commerce giant Shopify SHOP is bringing stablecoin payments to its merchants over … By CoinDesk 2025-06-12
Bitcoin price fractal points to bull trap that could send BTC below $100K !Bitcoin price fractal points to bull trap that could send BTC below … By Cointelegraph 2025-06-12
USDC stablecoin launches on XRP Ledger !USDC stablecoin launches on XRP Ledger/images/news/usdc-stablecoin-launches-on-xrp-ledger/ecbc4ca0f392.jpg Circle's USDC has a market capitalization … By Cointelegraph 2025-06-12
Bitcoin and Gold: Tether's Latest Investment Boosts 'Dual Pillar Strategy' Stablecoin issuer Tether has bought a substantial stake in a Canadian gold company as part of its safe-haven asset strategy, which includes a growing … By Decrypt 2025-06-12
Trident Digital to create XRP treasury of up to $500M !Trident Digital to create XRP treasury of up to $500M/images/news/trident-digital-to-create-xrp-treasury-of-up-to-50/dd9ad213f7c3.jpg The reserve … By Cointelegraph 2025-06-12
Trump addresses Coinbase summit to discuss crypto plans !Trump addresses Coinbase summit to discuss crypto plans/images/news/trump-addresses-coinbase-summit-to-discuss-crypto-/5dd27840a7fb.jpg The US … By Cointelegraph 2025-06-12
Bitcoin Will Rally as U.S. Growth Improves, Crypto Bills Progress: Coinbase Research A more upbeat macroeconomic backdrop, growing corporate appetite for digital assets, and increased regulatory clarity will fuel a constructive … By CoinDesk 2025-06-12
Will GameStop Buy More Bitcoin? Shares Plunge Amid 'Black Box' Criticism Over Strategy The company’s stock price fell 22% on Thursday after it unveiled plans to offer investors $1.75 billion worth of convertible bonds. By Decrypt 2025-06-12
Deutsche Telekom, Alibaba Cloud, Vodafone are running nodes on Nillion !Deutsche Telekom, Alibaba Cloud, Vodafone are running nodes on … By Cointelegraph 2025-06-12
DeFi Adding $5B of Solana Buying Power With New Line of Credit DeFi Development Corp. DFDV, the Nasdaq-listed firm pursuing a solana SOL treasury strategy, is planning to get some more dry powder to boost its SOL … By CoinDesk 2025-06-12
This Browser Extension Converts Everything Into Bitcoin—Here's Why Opportunity Cost is a browser extension that displays every price in Bitcoin or Sats, hoping to serve as a memetic tool for mass adoption. By Decrypt 2025-06-12
Crypto rally fails, Israel-Iran tensions grow, BTC treasuries soar Crypto rally fails, Israel-Iran tensions grow, BTC treasuries soar FOMO HOUR EP377 Crypto pulls back after rally on Israel-Iran fears. US House votes … By Decrypt 2025-06-12
Donald Trump: Administration Will Work Toward 'Clear and Simple' Crypto Frameworks MANHATTAN — U.S. President Donald Trump again touted his crypto bona fides at a conference Thursday, telling an audience it was an "honor" to be … By CoinDesk 2025-06-12
The Protocol: Polygon, Once a Scaling Leader, Eyes a Revamp Welcome to The Protocol, CoinDesk's weekly wrap-up of the most important stories in cryptocurrency tech development. We’re Margaux Nijkerk and Sam … By CoinDesk 2025-06-12
USDT issuer Tether buys 32% stake in Canada’s gold royalty firm !USDT issuer Tether buys 32% stake in Canada’s gold royalty firm/images/news/usdt-issuer-tether-buys-32-stake-in-canadas-gold-r/9b005b8e6ea5.jpg … By Cointelegraph 2025-06-12
AVAX Rebounds From Key Support After 6% Plunge Avalanche AVAX found support after a substantial decline on the short-term, according to CoinDesk Research's technical analysis model. The token is … By CoinDesk 2025-06-12
NEAR Protocol Plunges 9% as Volatility Spikes Despite User Growth The NEAR Protocol token is navigating through a period of heightened volatility, showing a clear downtrend with strong resistance at $2.730 and … By CoinDesk 2025-06-12
AI can’t do it alone: Blockchain is the missing piece in next-gen gaming !AI can’t do it alone: Blockchain is the missing piece in next-gen … By Cointelegraph 2025-06-12
Crypto for Advisors: The Relationship Between Bitcoin and Altcoins In today’s Crypto for Advisors, Gregory Mallhttps://www.linkedin.com/in/gregory-mall-cfa-frm-211338137/, chief investment officer from Lionsoul … By CoinDesk 2025-06-12
TON Slips as Selling Pressure Mounts Despite Recovery Attempts Telegram’s cryptocurrency TON, TON is experiencing significant downward pressure on the short-term, according to CoinDesk Research's technical … By CoinDesk 2025-06-12
Bitcoin bulls halt $4K BTC price dip as US dollar hits new 3-year lows !Bitcoin bulls halt $4K BTC price dip as US dollar hits new 3-year … By Cointelegraph 2025-06-12
Singapore's Trident Digital Targets Mammoth $500M Raise to Establish XRP Treasury Singapore-based Trident Digital TDTH is looking to raise up to $500 million to build what it says will be one of the world’s first corporate … By CoinDesk 2025-06-12
Bitcoin, Ethereum Slip After CPI Shock—But Charts Still Say 'Not Bearish': Analysis Bitcoin dips to $107K after inflation data triggers a “sell the news” move—but Ethereum shows stronger technical momentum above key support. By Decrypt 2025-06-12
What Japan’s fiscal debt crisis means for global crypto markets !What Japan’s fiscal debt crisis means for global crypto markets/images/news/what-japans-fiscal-debt-crisis-means-for-global-cr/dd49fd06c218.jpg … By Cointelegraph 2025-06-12
Crypto ownership isn’t just lambos and bros anymore !Crypto ownership isn’t just lambos and bros anymore/images/news/crypto-ownership-isnt-just-lambos-and-bros-anymore/190e6ac60521.jpg The National … By Cointelegraph 2025-06-12
Bitcoin adoption fueled by ‘deglobalization,’ Trump’s ‘big, beautiful bill’ !Bitcoin adoption fueled by ‘deglobalization,’ Trump’s ‘big, beautiful … By Cointelegraph 2025-06-12
Crypto Lending Platform Morpho V2 Brings DeFi Closer to Traditional Finance Morpho,https://www.coindesk.com/business/2024/08/01/crypto-lending-firm-morpho-bags-50m-in-funding-round-led-by-ribbit-capital a permissionless … By CoinDesk 2025-06-12
Hong Kong to develop crypto tracking tool for money laundering !Hong Kong to develop crypto tracking tool for money laundering/images/news/hong-kong-to-develop-crypto-tracking-tool-for-mone/fbebb8055c27.jpg Hong … By Cointelegraph 2025-06-12
Bittrue Hacker Funnels $30M Through Tornado Cash, Made $9.3M by Trading Ether A hacker who stole $23 … By CoinDesk 2025-06-12
Interpol Infostealer Malware Crackdown Leads to 32 Arrests More than 20,000 IPs and domains were taken down and 41 servers seized as part of the coordinated operation. By Decrypt 2025-06-12
Crypto Lender Maple Partners with Liquid Staking Specialist Lido Finance Cryptocurrency lending firm Maple Finance has partnered with crypto staking specialist Lido Finance to offer stablecoin credit lines backed by … By CoinDesk 2025-06-12
CoinDesk 20 Performance Update: Chainlink (LINK) Drops 6.2%, Leading Index Lower CoinDesk Indiceshttps://www.coindesk.com/indices/ presents its daily market update, highlighting the performance of leaders and laggards in the … By CoinDesk 2025-06-12
Chainlink, JPMorgan, Ondo Finance complete crosschain treasury settlement !Chainlink, JPMorgan, Ondo Finance complete crosschain treasury … By Cointelegraph 2025-06-12
Conduit, Braza Group Debut Stablecoin Forex Swaps for Cross-Border Payments in Brazil Conduit, a stablecoin-focused cross-border payments provider, said on Thursday it has teamed up with Brazil's Braza Group for real-time foreign … By CoinDesk 2025-06-12
Tether Buys $82M Stake in Gold-Focused Investment Company Elemental Altus Stablecoin issuer Tether's investment arm bought a one-third stake in Elemental Altus ELE, a publicly listed precious metals investment company, for … By CoinDesk 2025-06-12
Dogecoin, Solana Stumble as Altcoins Hit by Market Correction Altcoins including DOGE, SOL and ADA outpaced Bitcoin’s losses Thursday morning, in what experts called a “routine” pullback. By Decrypt 2025-06-12
Tried automating crypto trades with Grok 3? Here’s what happens !Tried automating crypto trades with Grok 3? Here’s what happens/images/news/tried-automating-crypto-trades-with-grok-3-heres-w/f9a791b84eae.jpg … By Cointelegraph 2025-06-12
FBI Crypto Veteran Chris Wong Joins TRM Labs to Bolster Fight Against Illicit Finance Christopher Wong, a former FBI Supervisory Special Agent and a leading figure in the agency’s cryptocurrency investigations, has joined blockchain … By CoinDesk 2025-06-12
Mercurity Fintech to raise $800M for Bitcoin treasury, eyes 7,400 BTC !Mercurity Fintech to raise $800M for Bitcoin treasury, eyes 7,400 … By Cointelegraph 2025-06-12
Ether futures open interest hits $20B all-time high: Will ETH price follow? !Ether futures open interest hits $20B all-time high: Will ETH price … By Cointelegraph 2025-06-12
Crypto Daybook Americas: Bitcoin Drops as Mideast Tensions Rise, but $200K Still In Play By Francisco Rodrigues All times ET unless indicated otherwise A weaker dollar, subdued inflation and heightened tensions in the Middle East are … By CoinDesk 2025-06-12
Dollar Index Falls Below 98 for First Time in Three Years, Gives Room for Crypto Run The dollar index DXY, a measure of the U.S. dollar’s strength against a basket of major global currencies, dropped below 98 for the first time since … By CoinDesk 2025-06-12
FSB warns crypto nearing ‘tipping point’ as ties to TradFi deepen !FSB warns crypto nearing ‘tipping point’ as ties to TradFi deepen/images/news/fsb-warns-crypto-nearing-tipping-point-as-ties-to-/b637510c11c6.jpg … By Cointelegraph 2025-06-12
Strategy Launches STRD, Its Third 'Bitcoin-Backed' Preferred Stock on Nasdaq Strategy MSTR has officially launched trading of its third "bitcoin-backedhttps://x.com/saylor/status/1932784731109695668 preferred stock", STRD, on … By CoinDesk 2025-06-12
Cypherock X1 Review: A Crypto Hardware Wallet With a Slick Card-Based Security Model The Cypherock X1 employs a shard-based security model using cards with secure elements, to guard against the threat of wrench attacks. By Decrypt 2025-06-12
Crypto exchange Binance launches in Syria after Trump lifts sanctions !Crypto exchange Binance launches in Syria after Trump lifts … By Cointelegraph 2025-06-12
93% of all Bitcoin is already mined. Here’s what that means !93% of all Bitcoin is already mined. Here’s what that means/images/news/93-of-all-bitcoin-is-already-mined-heres-what-that/62e9fac3adde.jpg With 93% … By Cointelegraph 2025-06-12
ETH Bulls Tighten Grip as $393M Exits Exchanges and ETF Inflows Outpace Bitcoin Ether ETH ETH struggled to maintain Tuesday’s momentum, falling 0.15% to $2,758 amid selling pressure that emerged during U.S. afternoon trading on … By CoinDesk 2025-06-12
'A Business Necessity': India's AI Market Set to Triple, Hit $17 Billion by 2027, Says BCG India is home to 16% of the world’s AI talent, second only to the U.S., according to a new BCG report on the country’s booming AI sector. By Decrypt 2025-06-12
Jack Ma’s Ant International eyes stablecoin licenses in Singapore, Hong Kong !Jack Ma’s Ant International eyes stablecoin licenses in Singapore, Hong … By Cointelegraph 2025-06-12
Can Bitcoin fix Pakistan’s energy problem? The 2,000 megawatt mining strategy explained !Can Bitcoin fix Pakistan’s energy problem? The 2,000 megawatt mining strategy … By Cointelegraph 2025-06-12
Jack Ma's Ant International Seeks Stablecoin Licenses in Hong Kong, Singapore: Bloomberg The international unit of Alipay owner Ant Group plans to seek stablecoin licenses in Hong Kong and Singapore, Bloomberg reported on … By CoinDesk 2025-06-12
Crypto has killed the weekend: Hedge funds quietly scramble to adapt !Crypto has killed the weekend: Hedge funds quietly scramble to adapt/images/news/crypto-has-killed-the-weekend-hedge-funds-quietly-/2b55031cb204.jpg … By Cointelegraph 2025-06-12
Why is Bitcoin price down today? !Why is Bitcoin price down today?/images/news/why-is-bitcoin-price-down-today/bcd5813d9a9f.jpg Bitcoin is down 1.7% over the last 24 hours after … By Cointelegraph 2025-06-12
Bitcoin must avoid sub-$100K wick as traders digest 55% China tariffs !Bitcoin must avoid sub-$100K wick as traders digest 55% China … By Cointelegraph 2025-06-12
Mercurity Fintech Plans $800M Bitcoin Treasury, Eyes Russell 2000 Inclusion Mercurity Fintech Holding MFH is raising $800 million to establish a bitcoin BTC treasury, the company announced in a press … By CoinDesk 2025-06-12
Strong Uptake at 10-Year U.S. Debt Sale Eases Demand Concerns, 30-Year Sale's Up Next Wednesday's auction of 10-year U.S. Treasury notes undermined the narrative that investors are moving … By CoinDesk 2025-06-12
Alchemy Pay taps Backed to expand access to tokenized ETFs, stocks !Alchemy Pay taps Backed to expand access to tokenized ETFs, stocks/images/news/alchemy-pay-taps-backed-to-expand-access-to-tokeni/f0d837f49b20.jpg … By Cointelegraph 2025-06-12
Bitcoin-Based Stablecoin Network Plasma Raises Deposit Cap to $1B, Gets Filled in 30 Minutes Stablecoin-focused blockchain Plasma raised its deposit cap to $1 billion early Thursday — and hit that limit within 30 minutes. The new cap marks a … By CoinDesk 2025-06-12
XRP Slides 4% After Failing to Break $2.33 Resistance Level Thrice XRP XRP fell 3.7% over the past 24 hours, reversing from a daily high of $2.288 to close near $2.260 after three rejections at the $2.33 resistance … By CoinDesk 2025-06-12
Philippines Enacts Sweeping Crypto Rules, Mandates Licensing and Capital Requirements The new SEC framework imposes minimum capital, local incorporation, and strict data rules on crypto firms operating in the Philippines. By Decrypt 2025-06-12
Dogecoin Drops 7% After Brief Rally Amid Rising Hopes of a DOGE ETF Dogecoin DOGE experienced sharp swings over the past 24 hours, initially surging to 20 cents before falling to 19.1 cents, representing a 6.63% … By CoinDesk 2025-06-12
Bitcoin, Dogecoin, Ether Could See Profit-Taking Even as Macro Conditions Improve Bitcoin BTC held firm above $107,000 on Thursday, but signs of fatigue are beginning to surface across the broader crypto market as majors show early … By CoinDesk 2025-06-12
US Senators Probe Stablecoin Plans by Facebook Parent Meta Senators Warren and Blumenthal are demanding answers from Meta over renewed stablecoin plans, warning of risks to competition and privacy. By Decrypt 2025-06-12
DeFi Development to refile $1B Solana plan after SEC filing snag !DeFi Development to refile $1B Solana plan after SEC filing snag/images/news/defi-development-to-refile-1b-solana-plan-after-se/89a6c8350aa3.jpg … By Cointelegraph 2025-06-12
Michael Saylor shares how COVID-19 chaos drove him to Bitcoin !Michael Saylor shares how COVID-19 chaos drove him to Bitcoin/images/news/michael-saylor-shares-how-covid-19-chaos-drove-him/1c8576cc0669.jpg … By Cointelegraph 2025-06-12
US Bancorp studying stablecoins as crypto custody arm sees revival !US Bancorp studying stablecoins as crypto custody arm sees revival/images/news/us-bancorp-studying-stablecoins-as-crypto-custody-/4fcc9b4d245c.jpg … By Cointelegraph 2025-06-12
Peter Brandt’s 75% Bitcoin crash scenario ‘very unlikely’: Analyst !Peter Brandt’s 75% Bitcoin crash scenario ‘very unlikely’: Analyst/images/news/peter-brandts-75-bitcoin-crash-scenario-very-unlik/b70f55d300fb.jpg … By Cointelegraph 2025-06-12
French police make more arrests in crypto kidnapping case !French police make more arrests in crypto kidnapping case/images/news/french-police-make-more-arrests-in-crypto-kidnappi/a1ed916556ba.jpg The father … By Cointelegraph 2025-06-12
Bitcoin at $200K by Year-End is Now Firmly in Play, Analyst Says After Muted U.S. Inflation Data Wednesday's softer-than-expected U.S. inflation has likely set the stage for accelerated gains in bitcoin BTC, potentially to $200,000 by the end of … By CoinDesk 2025-06-12
Australian Woman Hit With Ten-Year Ban Over $9.6 Million Crypto Scheme ASIC has banned Glenda Rogan for misleading conduct after she allegedly transfered client funds into blacklisted crypto platform. By Decrypt 2025-06-12
Sweden’s H100 soars 45% in a day after raising $10M for Bitcoin treasury !Sweden’s H100 soars 45% in a day after raising $10M for Bitcoin … By Cointelegraph 2025-06-12
Startup DIMO Launches DePIN Venture in Japan to Help Automakers Monetize Vehicle Data The decentralized physical infrastructure platform wants to scale and improve data infrastructure for vehicles in Japan. By Decrypt 2025-06-12
Centralized Bitcoin treasuries hold 31% of BTC supply: Gemini !Centralized Bitcoin treasuries hold 31% of BTC supply: Gemini/images/news/centralized-bitcoin-treasuries-hold-31-of-btc-supp/33bee9c69336.jpg … By Cointelegraph 2025-06-12
No one will sell their Bitcoin once it taps $130K: Bitwise CEO !No one will sell their Bitcoin once it taps $130K: Bitwise CEO/images/news/no-one-will-sell-their-bitcoin-once-it-taps-130k-b/703c2a740e2b.jpg … By Cointelegraph 2025-06-12
Disney, Universal, DreamWorks Sue Midjourney, Call It a 'Bottomless Pit of Plagiarism' Hollywood studios are accusing Midjourney of rampant copyright infringement, citing unauthorized use of iconic characters. By Decrypt 2025-06-12
Circle gains 10% on deals with Brazil’s Matera, Altman’s World !Circle gains 10% on deals with Brazil’s Matera, Altman’s World/images/news/circle-gains-10-on-deals-with-brazils-matera-altma/f5f6071304a7.jpg USDC … By Cointelegraph 2025-06-12
Disney, Universal sue Midjourney — ‘bottomless pit of plagiarism’ !Disney, Universal sue Midjourney — ‘bottomless pit of plagiarism’/images/news/disney-universal-sue-midjourney-bottomless-pit-of-/4f7ca1b351f9.jpg … By Cointelegraph 2025-06-12
Bitcoin bulls are roaring back as BTC flirts with $112K !Bitcoin bulls are roaring back as BTC flirts with $112K/images/news/bitcoin-bulls-are-roaring-back-as-btc-flirts-with-/549230301a1f.jpg Bitcoin … By Cointelegraph 2025-06-12
Asia Morning Briefing: Institutional Buying Makes $3K ETH Likely, While AI Agents Seek Crypto Rails Good Morning, Asia. Here 's what's making news in the markets: Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and … By CoinDesk 2025-06-12
GameStop plunges 12% after proposing new $1.75B debt offering !GameStop plunges 12% after proposing new $1.75B debt offering/images/news/gamestop-plunges-12-after-proposing-new-1-75b-debt/ff38de557e97.jpg … By Cointelegraph 2025-06-12
Bitcoin Miner Bitdeer Boosts BTC Production as Mining Industry Rebounds Bitcoin miner Bitdeer reported an increase in BTC mined in May, an 18% jump from April, as the industry recovers from a tough spell. By Decrypt 2025-06-11
Alleged NYC Bitcoin Kidnappers Plead Not Guilty, Claim Accuser Was 'Laughing and Smiling' The two men charged with kidnapping a Bitcoin investor in NYC have pleaded not guilty as wild new details emerge in a court appearance. By Decrypt 2025-06-11
Bitcoin advocate TFTC launches browser extension for real-time BTC pricing !Bitcoin advocate TFTC launches browser extension for real-time BTC … By Cointelegraph 2025-06-11
ChatGPT Is Eating the Internet: OpenAI Commands 80% of AI Market A new Similarweb report reveals that ChatGPT commands 5.5 billion monthly visits while competitors struggle to make a fraction of that. By Decrypt 2025-06-11
Two defendants plead not guilty in crypto kidnapping and torture case !Two defendants plead not guilty in crypto kidnapping and torture … By Cointelegraph 2025-06-11
Bitcoin price prepares for volatility as spot supply vanishes !Bitcoin price prepares for volatility as spot supply vanishes/images/news/bitcoin-price-prepares-for-volatility-as-spot-supp/fc1ba3ae882d.jpg … By Cointelegraph 2025-06-11
Musk-Trump Truce Sends Dogecoin Skyward, With Ethereum Along for the Ride: Analysis Dogecoin skyrocketed after Elon Musk’s surprise apology to Trump amid fresh ETF optimism for the crypto market's leading meme coin. By Decrypt 2025-06-11
GameStop Stock Falls as Firm Plans $1.75 Billion Raise After Bitcoin Buy After stockpiling over $500 million worth of Bitcoin, GameStop is raising more funds that could well fuel future BTC purchases. By Decrypt 2025-06-11
GameStop Raising Another $1.75B for Potential Bitcoin Purchases GameStop GME, the embattled video game retailer turned meme stock, announced Wednesday a $1.75 billion convertible senior note offering. Proceeds … By CoinDesk 2025-06-11
Bitcoin price rally to $115K possible as US economic data exceeds expectations !Bitcoin price rally to $115K possible as US economic data exceeds … By Cointelegraph 2025-06-11
Forget Bitcoin: Publicly Traded Firm Building $500 Million Crypto Treasury With FET Publicly traded fitness products company Interactive Strength plans to buy Fetch.ai tokens over the next 12 months for product integration. By Decrypt 2025-06-11
US senators question Meta’s stablecoin plans amid GENIUS Act debate !US senators question Meta’s stablecoin plans amid GENIUS Act debate/images/news/us-senators-question-metas-stablecoin-plans-amid-g/f934ae0ad4e9.jpg … By Cointelegraph 2025-06-11
Safe Establishes New Development Firm to Attract Institutions and Tackle Crypto’s ‘Cyber Warfare’ Era Safe, the popular multiparty crypto wallet previously called Gnosis Safe, has launched a new development unit, Safe Labs, in a move aimed at … By CoinDesk 2025-06-11
Bitcoin, ETH price coil after inflation cools and US-China tariffs roll back !Bitcoin, ETH price coil after inflation cools and US-China tariffs roll … By Cointelegraph 2025-06-11
Tom Lee Mulls Roughed-Up Semler Scientific for 'Granny Shot' Portfolio The recent wave of companies adding bitcoin to their balance sheets has not yielded universally positive results. Semler Scientific SMLR, a medical … By CoinDesk 2025-06-11
GENIUS stablecoin bill passes key vote, advances in US Senate !GENIUS stablecoin bill passes key vote, advances in US Senate/images/news/genius-stablecoin-bill-passes-key-vote-advances-in/fd6fc22f7b99.jpg Weeks … By Cointelegraph 2025-06-11
Circle Stock Jumps as USDC Stablecoin Expands to Sam Altman's World Chain Shares of stablecoin issuer Circle spiked on Wednesday as its USDC token expands natively to another blockchain, World Chain. By Decrypt 2025-06-11
Senate Begins Passage of Stablecoin Bill as House Marks Market-Structure Wins The U.S. Senate took the initial steps toward final approval of its first major crypto legislation as members opened voting Wednesday on the bill to … By CoinDesk 2025-06-11
SUI Token Trades Flat Despite Signs of Strong ETF Momentum SUI SUI, the native token of the Sui blockchain, rose slightly over the past 24 hours before falling sharply after macroeconomic factors hit global … By CoinDesk 2025-06-11
Financial Advisors Remain Hesitant Towards Bitcoin — But Won’t Be for Long Almost a year and a half after bitcoin BTC spot exchange-traded funds were unleashed upon the U.S. financial system, financial advisors are still … By CoinDesk 2025-06-11
Crypto Industry’s Coveted Market Structure Bill Is Doomed, Lobbyists Say The landmark bill’s odds of passage have been derailed by macro political forces, crypto policy leaders believe. By Decrypt 2025-06-11
Meta's Stablecoin Plan Questioned by Democrats Ahead of Key Senate Vote Senate Democrats Elizabeth Warren and Richard Blumenthal want Meta to explain what its stablecoin plans are. In a … By CoinDesk 2025-06-11
Connecticut's Ban Throws Water on 2025 Trend of States Setting Up Crypto Investments Going against the recent trend of state governments in the U.S. pursuing cryptocurrency investments, the Connecticut General Assembly has thrown down … By CoinDesk 2025-06-11
How to set up and use AI-powered crypto trading bots !How to set up and use AI-powered crypto trading bots/images/news/how-to-set-up-and-use-ai-powered-crypto-trading-bo/6fd557e45f9e.jpg A practical … By Cointelegraph 2025-06-11
Price predictions 6/11: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, SUI, LINK !Price predictions 6/11: BTC, ETH, XRP, BNB, SOL, DOGE, ADA, HYPE, SUI, … By Cointelegraph 2025-06-11
Invesco Hires JP Morgan Veteran to Lead Its $1.6 Billion Crypto ETF Business The global asset manager, which boasts $1.8 trillion assets under management, has welcomed Kathleen Wrynn to manage its portfolio of crypto ETFs and … By Decrypt 2025-06-11
How to use ChatGPT for crypto strategy, signals, and sentiment !How to use ChatGPT for crypto strategy, signals, and sentiment/images/news/how-to-use-chatgpt-for-crypto-strategy-signals-and/a2a388488ea5.jpg Use … By Cointelegraph 2025-06-11
Developer accuses Ethereum Foundation of undermining devs, creating ‘secret’ teams !Developer accuses Ethereum Foundation of undermining devs, creating ‘secret’ … By Cointelegraph 2025-06-11
Payments Giant Stripe to Acquire Crypto Wallet Tech Firm Privy Stripe is cozying up to crypto even more with its latest acquisition, adding crypto wallet infrastructure firm Privy. By Decrypt 2025-06-11
‘Unique’ Bitcoin holder trend backs BTC’s next price discovery phase: Glassnode !‘Unique’ Bitcoin holder trend backs BTC’s next price discovery phase: … By Cointelegraph 2025-06-11
Gate Marks 12 Years in Crypto With ‘Evolving Vision’ The crypto exchange is celebrating its 12th anniversary with a sweeping brand transformation and pushes into AI and RWAs. By Decrypt 2025-06-11
Why You Are Thinking About Ethereum All Wrong Current narratives around Ethereum would suggest the blockchain network is in distress. EY's Paul Brody explains what the critics get wrong. By Decrypt 2025-06-11
Ether Surges Toward $3K on Tentative U.S.–China Trade Pact and Soft U.S. CPI Report Ether ETH ETH drifted around $2,770 for most of Tuesday until roughly 8 p.m. ET, when officials said negotiators in London had forged a draft … By CoinDesk 2025-06-11
Peaq and UAE bet on tokenized machines to power future economy !Peaq and UAE bet on tokenized machines to power future economy/images/news/peaq-and-uae-bet-on-tokenized-machines-to-power-fu/d7624ff7d6ba.jpg The … By Cointelegraph 2025-06-11
Digital Assets Are One Step Closer to Regulatory Clarity The United States is on the brink of a new technological frontier – one powered by blockchain and digital assets. These assets are not just the next … By CoinDesk 2025-06-11
Stripe to Acquire Crypto Wallet Startup Privy in Bid to Expand Web3 Capabilities Stripe is acquiring crypto wallet infrastructure provider Privy, as part of its broader plan to make blockchain tools easier to integrate into … By CoinDesk 2025-06-11
After stablecoin push, Stripe acquires crypto wallet developer Privy !After stablecoin push, Stripe acquires crypto wallet developer Privy/images/news/after-stablecoin-push-stripe-acquires-crypto-walle/c9cdbe9c53c4.jpg … By Cointelegraph 2025-06-11
ATOM Finds Support at $4.50 as Ethereum Whales Signal Potential Altcoin Season The Cosmos ecosystem token has established key support levels around $4.50 as traders navigate the complex interplay between traditional finance … By CoinDesk 2025-06-11
Ethereum whale opens $11M leveraged bet amid ETH price’s 30% rise potential !Ethereum whale opens $11M leveraged bet amid ETH price’s 30% rise … By Cointelegraph 2025-06-11
The Case for Investing in Digital Assets You’ve been at the forefront of creating digital asset products from an early stage. Why do you think investors should consider putting money into … By CoinDesk 2025-06-11
AAVE Breaks Key Resistance as DeFi Sector Heats Up AAVE's recent price action demonstrates remarkable strength, climbing another 3.8% over the past 24-hour period and now up 25% since Monday. The … By CoinDesk 2025-06-11
Crypto Exchange Bullish to Host $10M Trading Competition Cryptocurrency exchange Bullish has announcedhttps://bullish.com/news-insights/news/bullish-professional-trading-competition/ details for a trading … By CoinDesk 2025-06-11
PayPal Expands PYUSD Stablecoin to Stellar, Joining Ethereum and Solana The payment giant's stablecoin product will soon be available on the blockchain network behind XLM. By Decrypt 2025-06-11
Flashbots Veterans Raise $20M to Tackle Crypto User Experience With OneBalance OneBalance, a new developer platform designed to eliminate cross-chain UX friction, has raised $20 million in a Series A round, the company said in a … By CoinDesk 2025-06-11
OneBalance lands $20M to simplify crypto for developers !OneBalance lands $20M to simplify crypto for developers/images/news/onebalance-lands-20m-to-simplify-crypto-for-develo/325ab95b7352.jpg OneBalance … By Cointelegraph 2025-06-11
U.S. Strategic Bitcoin Reserve Marks Milestone in Institutional Adoption: Gemini The formation of a U.S. Strategic Bitcoin Reserve SBR marks a pivotal step in bitcoin’s BTC evolution as an institutional asset, crypto exchange … By CoinDesk 2025-06-11
Litecoin Rebounds, Holds Firm Near $93 on Potential ETF Positioning Litecoin LTC recovered from am overnight sell-off, rising more than 2% and reaffirming support near $93. The bounce coincided with gains in … By CoinDesk 2025-06-11
Bitdeer Ramps Up Self-Mining Capacity, Ships 1.6 EH/s of SEALMINER A2s in May Bitcoin BTC mining firm Bitdeer BTDR increased its self-mining capacity and expanded its international operations in May, according to the company’s … By CoinDesk 2025-06-11
Ethereum ETFs Record Best Day in 4 Months With $125 Million in Investments Spot Ethereum ETFs generated $125 million in inflows on Tuesday, representing their best daily performance since early February. By Decrypt 2025-06-11
When an AI says, ‘No, I don’t want to power off’: Inside the o3 refusal !When an AI says, ‘No, I don’t want to power off’: Inside the o3 … By Cointelegraph 2025-06-11
Filecoin Rises 3.6% After Establishing Support Zone Around $2.68 Filecoin FIL has established a higher trading range amid significant market volatility, with multiple price bounces confirming support levels around … By CoinDesk 2025-06-11
BTC stable ahead of CPI, SOL ETFs coming soon, SPX hits ATH BTC stable ahead of CPI, SOL ETFs coming soon, SPX hits ATH FOMO HOUR EP376 BTC steady ahead of CPI today. SOL outperforms, SEC may approve staking … By Decrypt 2025-06-11
Trump’s consumer protection reforms could leave crypto users in a lurch !Trump’s consumer protection reforms could leave crypto users in a … By Cointelegraph 2025-06-11
TON Slides as Sell-Off Triggers Spike in Volume With Potential Bearish Pressure Signal TON, the Telegram-linked cryptocurrency, saw a short-term bearish-to-bullish reversal pattern in recent trading, finding key support at $3.25 after … By CoinDesk 2025-06-11
Trump’s CFTC chair pick won’t push president for bipartisan commission !Trump’s CFTC chair pick won’t push president for bipartisan … By Cointelegraph 2025-06-11
BNB Pushes Higher Despite Market Turbulence, Testing Resistance Near $674 Binance’s BNB token moved higher in the last 24 hours, defying broad market unease driven by geopolitical and economic crosswinds. The coin gained … By CoinDesk 2025-06-11
Why the Market Needs a Rules-Based Benchmark for Centralised Exchanges Despite billions flowing through centralised exchanges daily, there remains no consistent way to evaluate their underlying operational quality. … By CoinDesk 2025-06-11
Currency must be separated from state: Returning to Bitcoin's original vision !Currency must be separated from state: Returning to Bitcoin's original … By Cointelegraph 2025-06-11
AVAX Adds 4% as $22 Support Zone Holds Avalanche’s AVAX AVAX token has established strong support around the $22 level, successfully defending against multiple downward tests, according to … By CoinDesk 2025-06-11
What is a supply chain attack in crypto and how to prevent it? !What is a supply chain attack in crypto and how to prevent it?/images/news/what-is-a-supply-chain-attack-in-crypto-and-how-to/f5738c0be462.jpg … By Cointelegraph 2025-06-11
Hyperliquid Token Leads Altcoin Rebound as Bitcoin Price Steadies HYPE token outperforms major cryptos with 12.4% weekly gains as Hyperliquid's DEX gains traction in perpetual futures trading. By Decrypt 2025-06-11
Bitcoin Climbs Slightly as US Reports Inflation Slowed in May Bitcoin climbs toward $110K as May inflation comes in lower than expected, boosting hopes for Fed rate cuts and crypto momentum. By Decrypt 2025-06-11
Dogecoin Is About to Get a Flood of Games Via DogeOS and PlaysOut DogeOS will facilitate the launch of approximately 15 casual games via PlaysOut, with Dogecoin rewards and Doginals-based assets. By Decrypt 2025-06-11
What is LIBRA? The Solana Meme Coin That Sparked a Political Scandal LIBRA’s collapse triggered fraud claims, insider trading accusations, and calls for Argentine President Javier Milei’s impeachment. By Decrypt 2025-06-11
India CBI Busts Transnational Cybercrime Ring, Seizes $327K in Crypto The CBI’s investigation revealed advanced social engineering operations being used to exploit jurisdictional gaps to target foreign victims. By Decrypt 2025-06-11
Connecticut Flips State Bitcoin Reserve Trend, Bans All Government Crypto Investments Connecticut's comprehensive law overhauls digital asset regulations while 31 other states weigh Bitcoin reserve proposals. By Decrypt 2025-06-11
CLARITY Act Clears Two House Committees, Heads to House Floor for Vote Two House committees have advanced the CLARITY Act, setting the stage for a floor vote that could shift primary crypto oversight. By Decrypt 2025-06-11
Elite Footballers Named in $3.4 Million Crypto Fraud Case A Barcelona court has launched a criminal probe into crypto firm Shirtum after star footballers allegedly promoted a failed NFT scheme. By Decrypt 2025-06-11
Bullish Files for IPO as Trump's Crypto Pivot Drives Demand: FT Peter Thiel-backed crypto exchange Bullish is pursuing a public listing and follows last week's successful debuts from the crypto industry. By Decrypt 2025-06-11
Bank of Korea Governor to Meet Bank Chiefs as Stablecoin Debate Heats Up The upcoming meeting signals a shift in South Korea's approach to won-backed stablecoins as the new president eyes a regulatory overhaul. By Decrypt 2025-06-11
Why Strategy’s Bitcoin Buys Could Pose Long-Term Risks Despite Boosting Demand Swiss crypto bank Sygnum sees a potential concentration risk for Bitcoin that could deter central banks from adopting it as a reserve asset. By Decrypt 2025-06-11
OpenAI CEO Says We've Already Passed the 'Superintelligence Event Horizon' Sam Altman believes AI has crossed a key threshold into a new digital era of superintelligence. By Decrypt 2025-06-11
Feds Charge Crypto Founder With Evading U.S. Sanctions, Laundering $500M Evita Pay founder Iurii Gugnin is accused of turning his crypto firms into a "covert pipeline" for sanctioned Russian entities. By Decrypt 2025-06-10
Bank of Japan pivot to QE may fuel Bitcoin rally — Arthur Hayes !Bank of Japan pivot to QE may fuel Bitcoin rally — Arthur Hayes/images/news/bank-of-japan-pivot-to-qe-may-fuel-bitcoin-rally-a/e9e6703cab79.jpg The … By Cointelegraph 2025-06-10
ChatGPT Global Outage Drags on for Hours—Here's What We Know ChatGPT suffers 3-hour worldwide outage affecting millions of users, with OpenAI investigating "elevated error rates" across most services. By Decrypt 2025-06-10
What Next as Ether Zooms 7%, DOGE Leads Majors Gains Amid Bitcoin Euphoria Ether posted a sharp 7% gain in the past 24 hours as bitcoin’s steady climb past $109,000 boosted an otherwise flat crypto market. Dogecoin added … By CoinDesk 2025-06-10
Why is the crypto market up today? !Why is the crypto market up today?/images/news/why-is-the-crypto-market-up-today/6d868e52cf49.jpg The crypto market is up today, reflecting … By Cointelegraph 2025-06-10
Strategy Shifts Capital Raise to Preferred Stocks as Common Share Issuance Loses Allure Disclaimer: The analyst who wrote this piece owns shares of Strategy MSTR. Over the past two weeks, Strategy MSTR has refrained from utilizing the … By CoinDesk 2025-06-10
Trump’s CFTC pick calls blockchain a society-shaping technology !Trump’s CFTC pick calls blockchain a society-shaping technology/images/news/trumps-cftc-pick-calls-blockchain-a-society-shapin/4f7d2f71af16.jpg … By Cointelegraph 2025-06-10
Riot Sells $1.58M of Bitfarms Shares as Part of Investment Review Bitcoin BTC miner Riot Platforms RIOT said it sold 1.75 million shares of rival Bitfarms BITF for about $1.58 million as part of a continuing review … By CoinDesk 2025-06-10
Bitcoin Coinbase Premium hits 4-month high as 550K BTC leaves exchanges !Bitcoin Coinbase Premium hits 4-month high as 550K BTC leaves … By Cointelegraph 2025-06-10
SocGen’s Crypto Arm Unveils Dollar Stablecoin on Ethereum and Solana SG Forge, the cryptocurrency division of French bank Société Générale, plans to introduce a dollar-backed … By CoinDesk 2025-06-10
Why is Bitcoin price up today? !Why is Bitcoin price up today?/images/news/why-is-bitcoin-price-up-today/7e3e85455939.jpg Bitcoin price recovers above $109,000 as multiple BTC … By Cointelegraph 2025-06-10
Ripple commits $5M more toward crypto research in APAC !Ripple commits $5M more toward crypto research in APAC/images/news/ripple-commits-5m-more-toward-crypto-research-in-a/ce854df6b8ed.jpg The funds are … By Cointelegraph 2025-06-10
Société Générale launches US dollar stablecoin on Ethereum and Solana !Société Générale launches US dollar stablecoin on Ethereum and … By Cointelegraph 2025-06-10
Crypto social media sees rising interest in AI taking jobs: Santiment !Crypto social media sees rising interest in AI taking jobs: … By Cointelegraph 2025-06-10
South Korea moves to legalize stablecoins with new crypto bill !South Korea moves to legalize stablecoins with new crypto bill/images/news/south-korea-moves-to-legalize-stablecoins-with-new/01497f8b9584.jpg South … By Cointelegraph 2025-06-10
Bitcoin lacks strong catalyst to beat its $112K ATH: Analyst !Bitcoin lacks strong catalyst to beat its $112K ATH: Analyst/images/news/bitcoin-lacks-strong-catalyst-to-beat-its-112k-ath/c04497c2fd12.jpg … By Cointelegraph 2025-06-10
Canary Capital spins up Delaware trust for staked Injective ETF !Canary Capital spins up Delaware trust for staked Injective ETF/images/news/canary-capital-spins-up-delaware-trust-for-staked-/aefe482a7fd2.jpg Fund … By Cointelegraph 2025-06-10
Crypto scammers plead guilty to $37M scheme targeting Americans !Crypto scammers plead guilty to $37M scheme targeting Americans/images/news/crypto-scammers-plead-guilty-to-37m-scheme-targeti/b4674ebca61d.jpg Five … By Cointelegraph 2025-06-10
Amazon doubles down on AI with $20B Pennsylvania investment !Amazon doubles down on AI with $20B Pennsylvania investment/images/news/amazon-doubles-down-on-ai-with-20b-pennsylvania-in/710b20a894c6.jpg Amazon … By Cointelegraph 2025-06-10
Crypto platform Parataxis eyes public listing via SPAC merger !Crypto platform Parataxis eyes public listing via SPAC merger/images/news/crypto-platform-parataxis-eyes-public-listing-via-/fe4095018532.jpg New … By Cointelegraph 2025-06-10
Bitcoin, US crypto stocks rise as more firms plan BTC buys !Bitcoin, US crypto stocks rise as more firms plan BTC buys/images/news/bitcoin-us-crypto-stocks-rise-as-more-firms-plan-b/969d266d0b49.jpg … By Cointelegraph 2025-06-10
BlackRock’s Bitcoin fund blows past $70B in record pace for ETFs !BlackRock’s Bitcoin fund blows past $70B in record pace for ETFs/images/news/blackrocks-bitcoin-fund-blows-past-70b-in-record-p/96dedb884cb8.jpg … By Cointelegraph 2025-06-10
Staked Ethereum hits all-time high as ETH tops $2.7K !Staked Ethereum hits all-time high as ETH tops $2.7K/images/news/staked-ethereum-hits-all-time-high-as-eth-tops-2-7/89884315897f.jpg The amount of … By Cointelegraph 2025-06-10
SEC eyes exemption framework to boost crypto innovation !SEC eyes exemption framework to boost crypto innovation/images/news/sec-eyes-exemption-framework-to-boost-crypto-innov/6beba6c79ceb.jpg Securities … By Cointelegraph 2025-06-10
Asia Morning Briefing: BTC Slips Below $110K as 'Signs of Fatigue' Emerging Good Morning, Asia. Here 's what's making news in the markets: Welcome to Asia Morning Briefing, a daily summary of top stories during U.S. hours and … By CoinDesk 2025-06-10
UK appoints specialist to recover crypto from bankruptcy cases !UK appoints specialist to recover crypto from bankruptcy cases/images/news/uk-appoints-specialist-to-recover-crypto-from-bank/ee46360dc10f.jpg The … By Cointelegraph 2025-06-10
Self-Driving Waymo Cars Torched During ICE Protest in Los Angeles Several Waymo self-driving taxis were destroyed amid growing tensions over ICE activity in Los Angeles. By Decrypt 2025-06-10
Apple Tones Down AI Hype While Showcasing Next iPhone, Mac Features At WWDC 2025, Apple introduced AI-powered updates and UX design overhaul—but the AI hype was taken down a notch. By Decrypt 2025-06-10
Crypto exec ran a ‘covert pipeline for dirty money,’ DOJ says !Crypto exec ran a ‘covert pipeline for dirty money,’ DOJ says/images/news/crypto-exec-ran-a-covert-pipeline-for-dirty-money-/9afddfeec42f.jpg Evita … By Cointelegraph 2025-06-09
SEC Chair bashes Gensler’s approach to crypto, defends self-custody !SEC Chair bashes Gensler’s approach to crypto, defends self-custody/images/news/sec-chair-bashes-genslers-approach-to-crypto-defen/fd181616e718.jpg … By Cointelegraph 2025-06-09
Bitcoin Soars Above $110K, Nearing Record as Ethereum and Dogecoin Rise Bitcoin's price jumped past $110,000 for the first time in about two weeks to lead a broader upturn in digital assets. By Decrypt 2025-06-09
Here’s what happened in crypto today !Here’s what happened in crypto today/images/news/heres-what-happened-in-crypto-today/cff243bd0be3.jpg Need to know what happened in crypto today? … By Cointelegraph 2025-06-09
Sui DeFi Exchange Cetus Back in Action After $233 Million Exploit Following a damaging protocol vulnerability in May, Sui decentralized exchange Cetus is back online with a compensation plan. By Decrypt 2025-06-09
Turnkey raises $30M for crypto open infrastructure layer !Turnkey raises $30M for crypto open infrastructure layer/images/news/turnkey-raises-30m-for-crypto-open-infrastructure-/532330f162fe.jpg Digital … By Cointelegraph 2025-06-09
Telegram founder Durov on arrest, detention in France: ‘I’m confused’ !Telegram founder Durov on arrest, detention in France: ‘I’m … By Cointelegraph 2025-06-09
US lawmakers propose amendment to crypto market structure bill before markup !US lawmakers propose amendment to crypto market structure bill before … By Cointelegraph 2025-06-09
Bitcoin Climbs Above $110K, 'At Crossroads' for Next Major Move Bitcoin's BTC quiet climb on Monday accelerated to its strongest price in June, rebounding from last week's decline to near all-time high levels. The … By CoinDesk 2025-06-09
BlackRock ETH accumulation, key price metrics forecast Ethereum rally to $3K !BlackRock ETH accumulation, key price metrics forecast Ethereum rally to … By Cointelegraph 2025-06-09
Aptos' APT Gains 4% on Significant Volume, Has More Potential Upside Aptos' APT token rallied more than 4% on significant volume, with momentum indicators suggesting more potential upside, according to CoinDesk … By CoinDesk 2025-06-09
Plasma Attracts $500 Million for ICO—And One Trader Spent $100K on Ethereum Gas Fees Are ICOs back? Stablecoin network Plasma just attracted $500 million worth of deposits for its sale, with one trader paying $100K for an edge. By Decrypt 2025-06-09
Paraguay Says Presidential X Post Promising Bitcoin Reserve a Hack The South American country is also not starting a strategic BTC reserve. Hackers asked readers to send the asset to a Bitcoin address. By Decrypt 2025-06-09
Bitcoin price shows strength, but will BTC bulls be able to push through $110K? !Bitcoin price shows strength, but will BTC bulls be able to push through … By Cointelegraph 2025-06-09
Why Bitcoin Implied Volatility Has Collapsed Amid Trump Trade Talks Bitcoin volatility hits 1-year low as U.S.-China trade talks resume, with BTC holding above $100K but trapped in range amid geopolitical uncertainty. By Decrypt 2025-06-09
'Bitcoin First' KULR Technology Seeks $300 Million to Boost BTC Holdings The publicly traded company holds 920 Bitcoin, worth just under $1 billion on Monday. By Decrypt 2025-06-09
Bitcoin Avoids Death Cross, Ethereum Stabilizes and Fartcoin Defies Gravity: Analysis Technical indicators signal potential rebounds for Bitcoin and Ethereum while Fartcoin meme coin momentum accelerates. By Decrypt 2025-06-09
Bitcoin Treasury The Blockchain Group Eyes $342 Million Raise to Buy More BTC The publicly traded firm aims to amass more Bitcoin for its corporate treasury through an “at-the-market”-type offering, in partnership with a … By Decrypt 2025-06-09
Bitcoin chart pattern, return of ‘HODL mode’ point to imminent all-time BTC price high !Bitcoin chart pattern, return of ‘HODL mode’ point to imminent all-time BTC price … By Cointelegraph 2025-06-09
Paraguay warns of ‘irregular activity’ after post claiming BTC is legal tender !Paraguay warns of ‘irregular activity’ after post claiming BTC is legal … By Cointelegraph 2025-06-09
Hong Kong to use Chainlink protocol in CBDC pilot project !Hong Kong to use Chainlink protocol in CBDC pilot project/images/news/hong-kong-to-use-chainlink-protocol-in-cbdc-pilot-/d5de04bd5ead.jpg The study … By Cointelegraph 2025-06-09
Trump Media and Semler Scientific Could Be Cheapest Bitcoin Treasury Companies by This Metric A tsunami of new bitcoin BTC treasury companies — firms that almost exclusively dedicate themselves to accumulating bitcoin — is flooding the market. … By CoinDesk 2025-06-09
U.S. SEC Chair Says Working on 'Innovation Exemption' for DeFi Platforms The U.S. Securities and Exchange Commission is working on policy to exempt decentralized finance DeFi platforms from regulatory barriers, said … By CoinDesk 2025-06-09
Plasma’s XPL Token Sale Attracts $500M as Investors Chase Stablecoin Plays Plasma, a crypto startup developing a blockchain optimized for stablecoins, attracted $500 million in deposits for its token sale on Monday — 10 … By CoinDesk 2025-06-09
Paraguay President's X Account Hacked, Shares Bitcoin Scam The X account of the President of Paraguay, Santiago Peña, was hacked on Monday. The account posted that Paraguay was making bitcoin BTC legal … By CoinDesk 2025-06-09
Justin Sun-Linked BiT Global Drops Coinbase Lawsuit Over Wrapped Bitcoin Following the case dismissal, Coinbase Chief Legal Officer Paul Grewal said the exchange has "zero plans" to relist Wrapped Bitcoin WBTC. By Decrypt 2025-06-09
Argentine President Milei Exonerated in Libra Meme Coin Probe Milei promoted the Solana-based meme coin in February—and caused a stir. By Decrypt 2025-06-09
Red-Hot Circle Already Has Two ETFs Devoted to It in the Works Two well-known ETF issuers are racing to bring funds to market that track the explosive rise of Circle’s newly public stock. Bitwise and ProShares … By CoinDesk 2025-06-09
Bitcoin, Solana Rise as US and China Agree to Trade Talks Ahead of Key Bond Auction A poorly received 20-year bond auction caused Bitcoin’s price to suddenly drop last month. By Decrypt 2025-06-09
Circle Stock Hits New Peak, Up 347% Since IPO as Institutional Interest in CRCL Explodes Circle stock rockets 347% in three days as institutions pile in, but rate cuts loom as a potential headwind for the stablecoin issuer. By Decrypt 2025-06-09
BNB Price Climbs in Strong Rebound as Trump-Musk Spat Uncertainty Fades BNB, the native token of the Binance ecosystem, staged a swift comeback after a jolt of market turbulence rattled the broader crypto market. The coin … By CoinDesk 2025-06-09
Chainlink's LINK Stages V-Shape Recovery After 14% Plunge Chainlink LINK, the oracle network that helps bridging blockchain networks with external data, experienced significant price volatility in recent … By CoinDesk 2025-06-09
UK Appoints First Crypto Specialist for Insolvencies The U.K.'s Insolvency Service, responsible for returning assets to creditors in bankruptcy cases, said it appointed its first crypto intelligence … By CoinDesk 2025-06-09
AVAX Forms Critical Short-Term Support at $20.25 Level Avalanche's AVAX AVAX token continues to demonstrate significant volatility as it weakens following its recent rally. After initially rising 3.72% … By CoinDesk 2025-06-09
BTC edges Higher, Plasma ICO today, Inflation Data this week BTC edges Higher, Plasma ICO today, Inflation Data this week FOMO HOUR EP374 BTC: 107.7k +3%, ETH: 2540 +2%, SOL: 155 +5%. Top Gainers: ICP, SPX, … By Decrypt 2025-06-09
KULR Plans to Raise Up to $300M to Fuel Bitcoin Purchases Energy-management firm KULR KULR is looking to raise up to $300 million by selling shares of its common stock in an at-the-market ATM offering … By CoinDesk 2025-06-09
TON Surges 2.7% on Massive Volume Before Sharp Reversal TON-USD climbed from $3.156 to $3.24, showing remarkable strength with a 2.66% gain during a powerful breakout supported by high trading volume, … By CoinDesk 2025-06-09
SUI Surges 5% on Triple Volume Breakout Amid Trade Talks Between U.S. and China Global markets are navigating choppy waters as delegations from both the U.S. and China are meeting in London to discuss solutions in the ongoing … By CoinDesk 2025-06-09
Avalanche Meme Coin Trenches Heat Up as AVAX Lambo Token Touches $25 Million Traders have bridged to Avalanche to start trading meme coins, as SocialFi app The Arena sees activity explode. By Decrypt 2025-06-09
Circle Goes Full Circle By sheer luck, I had an opening bell media hit with NYSE TV this last Thursday, the day Circle listed as CRCL. The NYSE studio is upstairs at gallery … By CoinDesk 2025-06-09
Strategy Buys $110 Million in Bitcoin as BTC Holdings Near $63 Billion The Tysons Corner, Virginia-based firm announced a Bitcoin purchase for the ninth week in a row. By Decrypt 2025-06-09
Can Crypto Unlock the Vibe Launch? This year has seen the emergence of a new Internet person empowered by AI coding tools to build software for the Internet’s long tail: the vibe … By CoinDesk 2025-06-09
The End of Bitcoin Maximalism The launch of Bitcoin in 2009 created a resilient and decentralized monetary asset. Early adherents rallied around it as a singular innovation — … By CoinDesk 2025-06-09
Ethereum Blockchain Is Useful Technology That 'Deserves Love,' Bernstein Says The Ethereum blockchain's unique selling point is its role as a decentralized computer, Wall Street broker Bernstein said in a research report … By CoinDesk 2025-06-09
Ethereum ETFs Have Seen 15 Straight Days of Green—Here's Why Ethereum ETFs notch 15-day winning streak with $837M inflows as institutional investors shift focus from speculative Bitcoin to ETH infrastructure. By Decrypt 2025-06-09
ATOM Struggles After Failed Breakout, Recovers With New Support at $4.237 ATOM ATOM, the token of the Cosmos ecosystem, experienced volatility over the past 24 hours, with the price ranging 2.76% and peaking at $4.327. … By CoinDesk 2025-06-09
CoinDesk 20 Performance Update: Internet Computer (ICP) Surges 21.4% Over Weekend CoinDesk Indiceshttps://www.coindesk.com/indices/ presents its daily market update, highlighting the performance of leaders and laggards in the … By CoinDesk 2025-06-09
Australia Charges Four Over $123M Crypto Money Laundering Ring Crypto, cash, and property were seized after raids on a Gold Coast firm accused of running a laundering network via fake businesses. By Decrypt 2025-06-09
This Week in Crypto Games: Bonk 'Kill-to-Earn' Solana Launch, 'FIFA Rivals' Nears Release Solana meme coin game Bonk Arena goes live, FIFA Rivals is just days away, Flappy Bird swoops back towards crypto, and more. By Decrypt 2025-06-08
'Dogecoin Millionaire' Is Now a Pepe Millionaire—And He’s Stacking These Meme Coins Next "Dogecoin Millionaire" Glauber Contessoto still hasn't sold his DOGE, but now he's amassed enough Pepe to take on another title. By Decrypt 2025-06-08
To Reap Tokenization's Benefits, Accredited Investor Rules Should Be Revamped: Robinhood Crypto GM Robinhood Crypto's Johann Kerbrat said that tokenization could eliminate “middlemen” to the advantage of startup founders. By Decrypt 2025-06-08
AI Is Coming for Your Job, Much Faster Than Anyone Thought White-collar workers are facing displacement due to AI—and AGI hasn't even arrived yet. Here's why experts are raising alarms. By Decrypt 2025-06-08
DOJ Seeks $7.7 Million Forfeiture in Crypto From North Korean Hackers Masquerading as IT Workers DOJ seeking $7.74M in crypto from North Korean IT workers who used fake identities to infiltrate U.S. companies and fund the regime. By Decrypt 2025-06-08
Cudis Bets on Wearables, AI and a Solana Token to Drive the Longevity Movement Smart ring startup Cudis rewards users with crypto—via its new Solana and BNB token—for building consistent, healthy habits. By Decrypt 2025-06-07
SuiPlay0X1 Hands-On Preview: A Steam Deck Rival That Supports Crypto Games Launching at $599, the SuiPlay0X1 is a high-end mobile PC gaming device with crypto features. We went hands-on ahead of the release. By Decrypt 2025-06-07
French Exoskeleton Company Wandercraft Pivots to Humanoid Robots Wandercraft repurposed the technology behind its exoskeletons to create Calvin 40, a utilitarian bot for factory jobs. By Decrypt 2025-06-07
Trump's SEC Is Ending Crypto Lawsuits and Investigations—These Are the Biggest Under President Trump, the U.S. Securities and Exchange Commission is backing down from fights with crypto firms. Here's the growing list of former … By Decrypt 2025-06-07
